UNIVERSIDADE FEDERAL DE VIÇOSA BIOINFORMÁTICA ESTRUTURAL: PREDIÇÃO DE ESTRUTURA 3D DE PROTEÍNAS

Tamanho: px
Começar a partir da página:

Download "UNIVERSIDADE FEDERAL DE VIÇOSA BIOINFORMÁTICA ESTRUTURAL: PREDIÇÃO DE ESTRUTURA 3D DE PROTEÍNAS"

Transcrição

1 UNIVERSIDADE FEDERAL DE VIÇOSA BIOINFORMÁTICA ESTRUTURAL: PREDIÇÃO DE ESTRUTURA 3D DE PROTEÍNAS

2 2 BIOINFORMÁTICA ESTRUTURAL Área da bioinformática que se aplica ao estudo da estrutura das moléculas Desafio da era pós-genômica: compreender as funções observar a estrutura das proteínas Técnicas experimentais: Cristalografia de raios X RMN

3 3 POR QUE MODELAR? Aumento do número de projetos de seqüenciamento Limitação da predição experimental de estruturas protéicas Aumento das técnicas de predição teórica

4 4 TÉCNICAS IN SILICO Modelagem Comparativa: Usa como molde a estrutura 3D de outra proteína de referência (resolvida experimentalmente e com coordenadas cartesianas depositadas em banco dedados de estruturas) Predição de Enovelamento de Proteínas (Threading): Tenta-se ajustar a estrutura da proteína de interesse aos tipos de enovelamentos de proteínas conhecidas (atualmente mais de 1000 tipos já foram registrados) e depositados em bibliotecas de enovelamentos Predição por Primeiros Princípios (ab initio): Baseia-se nas propriedades físico-químicas conhecidas de cada aminoácido para a construção de funções de energia. Estas funções são minimizadas por algoritmos que realizam buscas no espaço de conformações que a proteína de interesse possa assumir

5 5 LIMITE DOS MÉTODOS DE PREDIÇÃO DE ESTRUTURAS 3D

6 6 O enovelamento protéico permite que aminoácidos seqüencialmente distantes interajam em uma mesma região espacial da proteína, formando distintos padrões conformacionais, dependendo das condições físico-químicas do ambiente. O alinhamento estrutural entre proteínas consideradas de uma mesma família, mesmo que seja apenas na região do sitio ativo, pode ser um importante método para se inferir a função da seqüência em estudo. A evolução tende a conservar funções que dependem mais diretamente das estruturas 3D que das similaridades entre as seqüências de aminoácidos das proteínas.

7 7 A metodologia se baseia no fato de que duas proteínas com função similar possuem similaridade estrutural. Por isso e possível usar estruturas resolvidas experimentalmente como moldes para construção de um modelo estrutural da seqüência da proteína de interesse. Lp1NTPDase e RnNTPDase2: 26% de identidade

8 8

9 9

10 10 Identificação de Referências e Seleção de Molde(s): >Seqüência alvo (formato FASTA) MADNAMTRGSRACYNCGQPGHLSRECPTRPPGVMGDRACYNCGR MGHLSRECPTRPPGVMGDRACYNCGRMGHLSRECPNRPAGGFRGVA RGACYHCQQEGHLARDCPNAPPGGERACYNCGQTGHTSRACPVK Busca por proteínas homologas no PDB (via BLAST): Para uma seqüência ser considerada como candidata a estrutura de referencia, é necessário que haja no mínimo 25-30% de identidade entre as seqüência primarias. Estudo estrutural detalhado das moléculas homologas: Busca por domínios, região catalítica, sítios alostéricos, etc.

11 11

12 12

13 13 Análise da Estrutura Secundária

14 14 Alinhamento Estrutural Cálculo do RMSD (Root Mean Square Deviation): É a medida da distância média entre os átomos de proteínas sobreposta. Lp1NTPDase e RnNTPDase2: RMSD=3,73Â

15 15

16 16 Alinhamento simples (formato PIR) 1) Alinha a segunda seqüência ao longo de toda a extensão da primeira, de forma a coincidir o maior numero de resíduos idênticos e similares. 3) Resulta na abertura de tantos gaps quantos forem necessários. 4) Atenção para a presença de heteroatomos, águas e ligantes.

17 17 Alinhamento Múltiplo (formato PIR) Código P1 Informação sobre a estrutura Estrutura desconhecida

18 18

19 19 Modelagem simples

20 20 Modelagem múltipla

21 21 Modelagem com pontes dissulfeto

22 22

23 23

24 24

25 25

26 26

27 27

DETERMINAÇÃO DA ESTRUTURA TRIDIMENSIONAL DE PROTEÍNAS POR DIFRAÇÃO DE RAIOS-X

DETERMINAÇÃO DA ESTRUTURA TRIDIMENSIONAL DE PROTEÍNAS POR DIFRAÇÃO DE RAIOS-X DETERMINAÇÃO DA ESTRUTURA TRIDIMENSIONAL DE PROTEÍNAS POR DIFRAÇÃO DE RAIOS-X Disciplina: Engenharia de Proteínas Ma. Flávia Campos Freitas Vieira NÍVEIS ESTRUTURAIS DAS PROTEÍNAS Fonte: Lehninger, 2010.

Leia mais

Arquitetura de domínios proteícos

Arquitetura de domínios proteícos Bioinformática Osmar NORBERTO DE SOUZA, PhD E-mail: osmar.norberto@pucrs.br Laboratório de Bioinformática, Modelagem e Simulação de Biossistemas - LABIO Faculdade de Informática Pontifícia Universidade

Leia mais

O que são domínios protéicos

O que são domínios protéicos Domínios protéicos O que são domínios protéicos Domínios protéicos é uma parte da cadeia polipeptídica que pode de enovelar independentemente para formar uma estrutura compacta e estável A existência de

Leia mais

Bioinformática. Alinhamento de Sequências. Prof. Msc. Rommel Ramos

Bioinformática. Alinhamento de Sequências. Prof. Msc. Rommel Ramos Bioinformática Alinhamento de Sequências Prof. Msc. Rommel Ramos 2013 Sumário 1. Comparação de Sequências 2. O que é alinhamento? 3. Tipos de Alinhamento 4. Algoritmos 5. Métodos de Alinhamento Comparação

Leia mais

Bancos de dados de biomacromoléculas e recuperação de informação

Bancos de dados de biomacromoléculas e recuperação de informação Bancos de dados de biomacromoléculas e recuperação de informação O fluxo da informação genética cirauqui@pharma.ufrj.br Bancos de dados Bancos de dados Ferramenta de extração de informação 1 Bancos de

Leia mais

Explorando bancos de dados genômicos e introdução à bioinformática. Guilherme Targino Valente Marcos Tadeu Geraldo. Bioinformática

Explorando bancos de dados genômicos e introdução à bioinformática. Guilherme Targino Valente Marcos Tadeu Geraldo. Bioinformática Explorando bancos de dados genômicos e introdução à bioinformática Guilherme Targino Valente Marcos Tadeu Geraldo 22/07/2011 Bioinformática É a aplicação de estatística e ciência da computação no campo

Leia mais

Modelagem Comparativa de Proteínas

Modelagem Comparativa de Proteínas Modelagem Comparativa de Proteínas Bioinformática Estrutural Aula 3 3 de Junho de 2013 Paula Kuser Falcão Laboratório de Bioinformática Aplicada Embrapa Informática Agropecuária Por que predizer a estrutura?

Leia mais

Bioinformática. Licenciaturas em Biologia, Bioquímica, Biotecnologia, Ciências Biomédicas, Engenharia Biológica. João Varela jvarela@ualg.

Bioinformática. Licenciaturas em Biologia, Bioquímica, Biotecnologia, Ciências Biomédicas, Engenharia Biológica. João Varela jvarela@ualg. Bioinformática Licenciaturas em Biologia, Bioquímica, Biotecnologia, Ciências Biomédicas, Engenharia Biológica João Varela jvarela@ualg.pt Docentes Paulo Martel (alinhamentos, pesquisas de sequências em

Leia mais

Evolução no repertório de proteínas. Marbella da Fonsêca Doutoranda Genética, UFRJ

Evolução no repertório de proteínas. Marbella da Fonsêca Doutoranda Genética, UFRJ Evolução no repertório de proteínas Marbella da Fonsêca Doutoranda Genética, UFRJ Proteínas Estrutura primária ordem dos aminoácidos ao longo da seqüência Alfa hélices e cadeias beta Forma final da molécula

Leia mais

XVIII Simpósio Brasileiro de Química Teórica SBQT 2015 Pirenópolis GO, 22-25 Novembro de 2015

XVIII Simpósio Brasileiro de Química Teórica SBQT 2015 Pirenópolis GO, 22-25 Novembro de 2015 Desenvolvimento de ferramenta para a inserção com baixa perturbação de proteínas de membrana em bicamadas lipídicas para simulações de Dinâmica Molecular Luiz Fernando da Costa Zonetti a,b, Alexandre Suman

Leia mais

Estrutura tridimensional de proteínas. Prof. Dr. Fernando Berton Zanchi

Estrutura tridimensional de proteínas. Prof. Dr. Fernando Berton Zanchi Estrutura tridimensional de proteínas Prof. Dr. Fernando Berton Zanchi Níveis de Estruturas Protéicas A conformação espacial das proteínas As proteínas não são traços rígidos porque suas ligações químicas

Leia mais

Anotação de Genomas. Fabiana G. S. Pinto

Anotação de Genomas. Fabiana G. S. Pinto Anotação de Genomas Fabiana G. S. Pinto Obtenção de Seqüências geradas pelo MegaBace 1000 Dados brutos (medidas analógicas) de saída do seqüênciamento Base calling BIOINFORMÁTICA * PHRED: - Transforma

Leia mais

Docking (ou atracamento) Molecular. Profa. Dra. Rafaela Ferreira Dept. de Bioquímica e Imunologia 9 de outubro de 2014

Docking (ou atracamento) Molecular. Profa. Dra. Rafaela Ferreira Dept. de Bioquímica e Imunologia 9 de outubro de 2014 Docking (ou atracamento) Molecular Profa. Dra. Rafaela Ferreira Dept. de Bioquímica e Imunologia rafaelasf@gmail.com 9 de outubro de 2014 O ATRACAMENTO MOLECULAR PERMITE ESTIMAR COMO DUAS MOLÉCULAS INTERAGEM

Leia mais

Bioinformática. Trabalho prático enunciado complementar. Notas complementares ao 1º enunciado

Bioinformática. Trabalho prático enunciado complementar. Notas complementares ao 1º enunciado Bioinformática Trabalho prático enunciado complementar Neste texto, enunciam- se algumas considerações adicionais ao 1º enunciado e uma lista de possíveis tarefas que complementam o enunciado original

Leia mais

Miguel Rocha Dep. Informática - Universidade do Minho. BIOINFORMÁTICA: passado, presente e futuro!!

Miguel Rocha Dep. Informática - Universidade do Minho. BIOINFORMÁTICA: passado, presente e futuro!! Miguel Rocha Dep. Informática - Universidade do Minho BIOINFORMÁTICA: passado, presente e futuro!! Bragança, 11 de Maio de 2006 Porquê a Bioinformática?! Novas tecnologias experimentais da Biologia Molecular

Leia mais

Bioinformática. João Varela jvarela@ualg.pt. Aula T4 CURSOS EM BIOLOGIA, BIOQUÍMICA, BIOTECNOLOGIA, CIÊNCIAS BIOMÉDICAS E ENGENHARIA BIOLÓGICA

Bioinformática. João Varela jvarela@ualg.pt. Aula T4 CURSOS EM BIOLOGIA, BIOQUÍMICA, BIOTECNOLOGIA, CIÊNCIAS BIOMÉDICAS E ENGENHARIA BIOLÓGICA Bioinformática CURSOS EM BIOLOGIA, BIOQUÍMICA, BIOTECNOLOGIA, CIÊNCIAS BIOMÉDICAS E ENGENHARIA BIOLÓGICA João Varela jvarela@ualg.pt Aula T4 Esquema de anotação Annothaton 1. Determinar a localização das

Leia mais

Modelagem por Homologia passo-a-passo. Prof. Rommel Ramos

Modelagem por Homologia passo-a-passo. Prof. Rommel Ramos Modelagem por Homologia passo-a-passo Prof. Rommel Ramos 1 Busca de um candidato a template Para identificar os melhores candidatos a template é necessário fazer o download do banco de dados de estruturas

Leia mais

Programa de Pós-Graduação Stricto Sensu em Biologia Computacional e Sistemas. Seleção de Mestrado 2012-B

Programa de Pós-Graduação Stricto Sensu em Biologia Computacional e Sistemas. Seleção de Mestrado 2012-B Programa de Pós-Graduação Stricto Sensu em Biologia Computacional e Sistemas Seleção de Mestrado 2012-B INSTRUÇÕES (LEIA ATENTAMENTE ANTES DE PREENCHER A PROVA): a. Identifique sua prova unicamente com

Leia mais

O processo da Expressão Gênica

O processo da Expressão Gênica Coordenadoria de Educação e Difusão de Ciências Rua 9 de Julho, 1205 - São Carlos - São Paulo e-mail: cbme@if.sc.usp.br- Telefone: (16) 3373-9159 http://cbme.ifsc.usp.br http://cbme.usp.br O processo da

Leia mais

17/10/2012. Bases Instrumentais de bioinformática aplicada à Epidemiologia Molecular das doenças transmissíveis. Fábio Gregori. O que é?

17/10/2012. Bases Instrumentais de bioinformática aplicada à Epidemiologia Molecular das doenças transmissíveis. Fábio Gregori. O que é? Bases Instrumentais de bioinformática aplicada à Epidemiologia Molecular das doenças transmissíveis Fábio Gregori O que é? Vantagens e desvantagens Ser mais completo,... Versões (Windows [32 bit], DOS,

Leia mais

ESTRUTURA DAS PROTEÍNAS

ESTRUTURA DAS PROTEÍNAS ESTRUTURA DAS PROTEÍNAS Aminoácidos ligam-se por ligações peptídicas = reação de condensação entre: OH do grupo carboxila de um aminoácido H do grupo amina do outro aminoácido ( liberação de uma molécula

Leia mais

Comunicado Técnico ISSN 1677-8464

Comunicado Técnico ISSN 1677-8464 Ministério da Agricultura, Pecuária e Abastecimento Comunicado Técnico Dezembro, 37 2002 Campinas, SP ISSN 1677-8464 Análise do Grau de Conservação de Resíduos em Proteínas com Estrutura 3D Resolvida Utilizando

Leia mais

Disciplina COD CR CH OB/CO/ELE Sábado Início Término Local Algoritmos e Programação. BCS01 4 60 OB 8h-12h 23/02 01/06

Disciplina COD CR CH OB/CO/ELE Sábado Início Término Local Algoritmos e Programação. BCS01 4 60 OB 8h-12h 23/02 01/06 Horário de aula 1º. Semestre de 2013 Disciplina COD CR CH OB/CO/ELE Sábado Início Término Local Algoritmos e Programação BCS01 4 60 OB 8h-12h 23/02 01/06 Professor: Ementa: Computadores e Ambientes de

Leia mais

John Fenn KoichiTanaka Kurt Wûthrich

John Fenn KoichiTanaka Kurt Wûthrich John Fenn KoichiTanaka Kurt Wûthrich...pelo desenvolvimento de métodos de ionização em espectrometria de massa para analise de macromoléculas biológicas...pelo desenvolvimento da Ressonância Magnética

Leia mais

Introdução ao SRS Sequence Retrieval System. Marcelo Falsarella Carazzolle

Introdução ao SRS Sequence Retrieval System. Marcelo Falsarella Carazzolle Introdução ao SRS Sequence Retrieval System Marcelo Falsarella Carazzolle Resumo Motivação Introdução Bancos de Dados Ferramentas de bioinformática SRS Exemplos Motivação Existem muitos bancos de dados

Leia mais

Estrutura e função dos ácidos nucléicos. Profa. Melissa de Freitas Cordeiro-Silva

Estrutura e função dos ácidos nucléicos. Profa. Melissa de Freitas Cordeiro-Silva Estrutura e função dos ácidos nucléicos Profa. Melissa de Freitas Cordeiro-Silva > Polímeros de nucleotídeos Funções: DNA (ácido desoxirribonucléico) : > Armazenar as informações necessárias para a construção

Leia mais

Modelagem molecular (Parte I) Predição da estrutura e aplicações em

Modelagem molecular (Parte I) Predição da estrutura e aplicações em Modelagem molecular (Parte I) Predição da estrutura e aplicações em engenharia de proteinas Sumario Métodos de determinação da estrutura de proteinas Principios Fundamentais Forças em Biomoléculas Modelagem

Leia mais

Bioinformática Aula 01

Bioinformática Aula 01 Bioinformática Aula 01 Prof. Ricardo Martins Ramos * * Doutorando em Genética e Toxicologia Aplicada CEFET-PI/ULBRA-RS Linha de Pesquisa Bioinformática Estrutural E-mail: ricardo@cefetpi.br Visão Holística

Leia mais

Determinação da Estrutura de Proteínas

Determinação da Estrutura de Proteínas Centro Brasileiro-Argentino de Biotecnologia Introdução à Biologia Computacional Determinação da Estrutura de Proteínas Paulo enrique C. Godoi Bioinformática objetivo principal é determinar a função de

Leia mais

Exame de Laboratórios de Bioquímica e Biofísica Licenciatura em Bioquímica 1ª Época 27 de Junho de 2006 Por favor responda às questões da 1ª parte e 2ª partes em folhas separadas 1ª Parte 1. Suponha que

Leia mais

Tutorial: QUÍMICA COMPUTACIONAL E MODELAGEM MOLECULAR. Profa. Nelilma Correia Romeiro

Tutorial: QUÍMICA COMPUTACIONAL E MODELAGEM MOLECULAR. Profa. Nelilma Correia Romeiro Tutorial: QUÍMICA COMPUTACIONAL E MODELAGEM MOLECULAR Profa. Nelilma Correia Romeiro Fevereiro de 2008 1 MODELAGEM MOLECULAR Modelagem molecular, segundo a IUPAC, é a investigação das estruturas e das

Leia mais

Uso do calcário no solo Desenvolvimento de pesticidas e fertilizantes. Máquinas a vapor substituindo a força animal

Uso do calcário no solo Desenvolvimento de pesticidas e fertilizantes. Máquinas a vapor substituindo a força animal Fepagro em foco Samuel Mazzinghy Alvarenga Histórico recente da Agropecuária Era científica: a partir de ~ 1.700 Rotação de culturas e métodos de cultivo intensivo Drenagem Utilização de arado, máquinas

Leia mais

ENZIMAS E METABOLISMO

ENZIMAS E METABOLISMO ENZIMAS E METABOLISMO Metabolismo Celular é o conjunto de todas as reacções químicas celulares acompanhadas de transferência de energia. ANABOLISMO conjunto de reacções químicas que conduzem à biossíntese

Leia mais

O processo da Expressão Gênica

O processo da Expressão Gênica INBEQMeDI Instituto Nacional de Biotecnologia Estrutural e Química Medicinal em Doenças Infecciosas Coordenadoria de Educação e Difusão de Ciências Telefone: (16) 3373-9159 Rua 9 de julho, 1205 - Centro

Leia mais

A hidroxiapatita (HA) é um constituinte natural dos ossos e possui de 30% a. 70% da massa dos ossos e dos dentes. Além de ter grande importância na

A hidroxiapatita (HA) é um constituinte natural dos ossos e possui de 30% a. 70% da massa dos ossos e dos dentes. Além de ter grande importância na 13 2 Hidroxiapatita 2.1. Aplicações biomédicas da hidroxiapatita A hidroxiapatita (HA) é um constituinte natural dos ossos e possui de 30% a 70% da massa dos ossos e dos dentes. Além de ter grande importância

Leia mais

Metodologias de Desenvolvimento de Sistemas. Analise de Sistemas I UNIPAC Rodrigo Videschi

Metodologias de Desenvolvimento de Sistemas. Analise de Sistemas I UNIPAC Rodrigo Videschi Metodologias de Desenvolvimento de Sistemas Analise de Sistemas I UNIPAC Rodrigo Videschi Histórico Uso de Metodologias Histórico Uso de Metodologias Era da Pré-Metodologia 1960-1970 Era da Metodologia

Leia mais

4 Programas computacionais

4 Programas computacionais 4 Programas computacionais No estudo em solução são usados programas computacionais que permitem calcular as constantes de estabilidade dos complexos formados e montar as curvas de distribuição de espécies.

Leia mais

Instruções Técnicas Licenciamento Prévio para Destinação Final de RESIDUOS DE FOSSA SÉPTICA

Instruções Técnicas Licenciamento Prévio para Destinação Final de RESIDUOS DE FOSSA SÉPTICA Instruções Técnicas Licenciamento Prévio para Destinação Final de RESIDUOS DE FOSSA SÉPTICA DISA INSTRUÇÕES PARA PREENCHIMENTO: As instruções necessárias para o preenchimento da folha de rosto deste formulário,

Leia mais

TEORIA DO ORBITAL MOLECULAR PARA MOLÉCULAS POLIATÔMICAS

TEORIA DO ORBITAL MOLECULAR PARA MOLÉCULAS POLIATÔMICAS UNIVERSIDADE FEDERAL FLUMINENSE INSTITUTO DE QUÍMICA DEPARTAMENTO DE QUÍMICA INORGÂNICA QUÍMICA INORGÂNICA FUNDAMENTAL TEORIA DO ORBITAL MOLECULAR PARA MOLÉCULAS POLIATÔMICAS Prof. Fabio da Silva Miranda

Leia mais

Laboratório de Física - 2011/2012. Propriedades físicas de um filme fino magnético. Centro de Física da Matéria Condensada da UL

Laboratório de Física - 2011/2012. Propriedades físicas de um filme fino magnético. Centro de Física da Matéria Condensada da UL T1 Propriedades físicas de um filme fino magnético Difracção raios X, Microscopia Força Atómica, Magnetometria SQUID Rui Borges Centro de da UL Estudo de um filme fino de óxido magnético depositado por

Leia mais

APLICAÇÕES DE RESSONÂNCIA MAGNÉTICA NUCLEAR NA AVALIAÇÃO DE OSTEOPOROSE

APLICAÇÕES DE RESSONÂNCIA MAGNÉTICA NUCLEAR NA AVALIAÇÃO DE OSTEOPOROSE IX Latin American IRPA Regional Congress on Radiation Protection and Safety - IRPA 2013 Rio de Janeiro, RJ, Brazil, April 15-19, 2013 SOCIEDADE BRASILEIRA DE PROTEÇÃO RADIOLÓGICA - SBPR APLICAÇÕES DE RESSONÂNCIA

Leia mais

Analise filogenética baseada em alinhamento de domínios

Analise filogenética baseada em alinhamento de domínios Analise filogenética baseada em alinhamento de domínios Moléculas biológicas e evolução Como já foi comentado anteriormente sabemos que o DNA de qualquer espécie de ser vivo sofre mutações ao longo do

Leia mais

UNIDADE 4 - ESTRUTURA CRISTALINA

UNIDADE 4 - ESTRUTURA CRISTALINA UNIDADE 4 - ESTRUTURA CRISTALINA 4.1. INTRODUÇÃO Em geral, todos os metais, grande parte dos cerâmicos e certos polímeros cristalizam-se quando se solidificam. Os átomos se arranjam em uma estrutura tridimensional

Leia mais

A UTILIZAÇÃO DO MÉTODO NODAL NA SIMULAÇÃO DE PROCESSOS TÉRMICOS

A UTILIZAÇÃO DO MÉTODO NODAL NA SIMULAÇÃO DE PROCESSOS TÉRMICOS A UTILIZAÇÃO DO MÉTODO NODAL NA SIMULAÇÃO DE PROCESSOS TÉRMICOS C. R. RODRIGUES VELOSO 1, R. GEDRAITE 2 1 Bolsista PIBIC FAPEMIG/UFU, discente do curso de Engenharia Química 2 Professor da Faculdade de

Leia mais

Medindo a Terra com Sombras

Medindo a Terra com Sombras Projecto apresentado no XI Encontro Nacional de Estudantes de Física, Faculdade de Ciências da Universidade do Porto, 27 Fevereiro - 1 Março de 2009, resultante de uma parceria entre a Sociedade Portuguesa

Leia mais

c = c = c =4,20 kj kg 1 o C 1

c = c = c =4,20 kj kg 1 o C 1 PROPOSTA DE RESOLUÇÃO DO TESTE INTERMÉDIO - 2014 (VERSÃO 1) GRUPO I 1. H vap (H 2O) = 420 4 H vap (H 2O) = 1,69 10 3 H vap (H 2O) = 1,7 10 3 kj kg 1 Tendo em consideração a informação dada no texto o calor

Leia mais

SAY NO TO SCHISTOSOMA: PROJETO DO WORLD COMMUNITY GRID IBM COM A FACULDADE INFÓRIUM DE TECNOLOGIA E A FIOCRUZ-MG

SAY NO TO SCHISTOSOMA: PROJETO DO WORLD COMMUNITY GRID IBM COM A FACULDADE INFÓRIUM DE TECNOLOGIA E A FIOCRUZ-MG SAY NO TO SCHISTOSOMA: PROJETO DO WORLD COMMUNITY GRID IBM COM A FACULDADE INFÓRIUM DE TECNOLOGIA E A FIOCRUZ-MG Salomão Ribeiro Pires 1 Rosangela Silqueira Hickson 2 Resumo: A Schistosomose é uma doença

Leia mais

Bases Moleculares da Hereditariedade

Bases Moleculares da Hereditariedade UNIVERSIDADE FEDERAL DO PIAUÍ CENTRO DE CIÊNCIAS AGRÁRIAS PROG. DE PÓS GRAD. EM GENET. E MELHORAMENTO NÚCLEO DE ESTUDOS EM GENET. E MELHORAMENTO Bases Moleculares da Hereditariedade Ministrante: João Paulo

Leia mais

Universidade Federal de Pelotas Faculdade de Agronomia Eliseu Maciel Programa de Pós-Graduação em Agronomia CENTRO DE GENOMICA E FITOMELHORAMENTO

Universidade Federal de Pelotas Faculdade de Agronomia Eliseu Maciel Programa de Pós-Graduação em Agronomia CENTRO DE GENOMICA E FITOMELHORAMENTO Universidade Federal de Pelotas Faculdade de Agronomia Eliseu Maciel Programa de Pós-Graduação em Agronomia CENTRO DE GENOMICA E FITOMELHORAMENTO Introdução à Bioinformática Professores: Luciano Maia Antonio

Leia mais

UNIVERSIDADE FEDERAL DO ABC BC-1105: MATERIAIS E SUAS PROPRIEDADES

UNIVERSIDADE FEDERAL DO ABC BC-1105: MATERIAIS E SUAS PROPRIEDADES UNIVERSIDADE FEDERAL DO ABC Centro de Engenharia, Modelagem e Ciências Sociais Aplicadas (CECS) BC-1105: MATERIAIS E SUAS PROPRIEDADES Estrutura Cristalina - arranjo (organização espacial) - simetria -

Leia mais

Cálculo Numérico Aula 1: Computação numérica. Tipos de Erros. Aritmética de ponto flutuante

Cálculo Numérico Aula 1: Computação numérica. Tipos de Erros. Aritmética de ponto flutuante Cálculo Numérico Aula : Computação numérica. Tipos de Erros. Aritmética de ponto flutuante Computação Numérica - O que é Cálculo Numérico? Cálculo numérico é uma metodologia para resolver problemas matemáticos

Leia mais

INTRODUÇÃO DA QUÍMICA VERDE, COMO SUPORTE DA SUSTENTABILIDADE, NO ENSINO SECUNDÁRIO

INTRODUÇÃO DA QUÍMICA VERDE, COMO SUPORTE DA SUSTENTABILIDADE, NO ENSINO SECUNDÁRIO VI Encontro da Divisão de Ensino e Divulgação da INTRODUÇÃO DA QUÍMICA VERDE, COMO SUPORTE DA SUSTENTABILIDADE, NO ENSINO SECUNDÁRIO TÂNIA C. M. PIRES 1,2, J. R. M. PINTO 1,2, M. G. T. C. RIBEIRO 1,2,

Leia mais

DESENVOLVIMENTO DE UM SOFTWARE DE GERAÇÃO E VISUALIZAÇÃO DE NANOESTRUTURAS

DESENVOLVIMENTO DE UM SOFTWARE DE GERAÇÃO E VISUALIZAÇÃO DE NANOESTRUTURAS DESENVOLVIMENTO DE UM SOFTWARE DE GERAÇÃO E VISUALIZAÇÃO DE NANOESTRUTURAS Aluno: Marcos Paulo Moraes Orientador: André Silva Pimentel Introdução A nanotecnologia está associada a diversas áreas de pesquisa

Leia mais

O surgimento da Bioinformática Banco de Dados Biológicos

O surgimento da Bioinformática Banco de Dados Biológicos Rede de Biodiversidade e Biotecnologia da Amazônia Legal Programa de Pós-Graduação da Bionorte FUNDAÇÃO UNIVERSIDADE FEDERAL DE RONDÔNIA NÚCLEO DE SAÚDE DEPARTAMENTO DE MEDICINA PROGRAMA DE PÓS-GRADUAÇÃO

Leia mais

Modelagem de dados e uso do SGBD MySQL

Modelagem de dados e uso do SGBD MySQL CURSO DE VERÃO EM BIOINFORMÁTICA ESTRUTURAL Modelagem de dados e uso do SGBD MySQL Modelagem e projeto de banco de dados Arquitetura de três esquemas [1] USUÁRIOS Nível externo Visão externa Mapeamento

Leia mais

Tecnologia e Sustentabilidade

Tecnologia e Sustentabilidade Painel 2 Tecnologia e Sustentabilidade Robério Fernandes Alves de Oliveira 1 Painel 2 Tecnologia e Sustentabilidade As dimensões da sustentabilidade Econômica Social AMBIENTAL 2 Painel 2 Tecnologia e Sustentabilidade

Leia mais

GUSTAVO FIGUEIREDO ARAÚJO CODIFICAÇÃO E CLUSTERING DE PROTEÍNAS

GUSTAVO FIGUEIREDO ARAÚJO CODIFICAÇÃO E CLUSTERING DE PROTEÍNAS GUSTAVO FIGUEIREDO ARAÚJO CODIFICAÇÃO E CLUSTERING DE PROTEÍNAS Monografia de graduação apresentada ao Departamento de Ciência da Computação da Universidade Federal de Lavras como parte das exigências

Leia mais

SUMÁRIO. Introdução... 3

SUMÁRIO. Introdução... 3 SUMÁRIO Introdução..................................... 3 1 Consultas por Similaridade e Espaços métricos............. 5 1.1 Consultas por abrangência e consultas aos k-vizinhos mais próximos... 5 1.2

Leia mais

Estrutura primária, secundária, terciária e quaternária de proteínas

Estrutura primária, secundária, terciária e quaternária de proteínas Pontifícia Universidade Católica do Rio Grande do Sul Bioinformática Estrutura primária, secundária, terciária e quaternária de proteínas Luís Fernando S.M. Timmers Porto Alegre, 11 de Agosto de 2015 Revisão

Leia mais

7.012 Conjunto de Problemas 5

7.012 Conjunto de Problemas 5 Nome Seção 7.012 Conjunto de Problemas 5 Pergunta 1 Enquanto estudava um problema de infertilidade, você tentou isolar um gene hipotético de coelho que seria responsável pela prolífica reprodução desses

Leia mais

Carta para a Preservação do Patrimônio Arquivístico Digital Preservar para garantir o acesso

Carta para a Preservação do Patrimônio Arquivístico Digital Preservar para garantir o acesso Carta para a Preservação do Patrimônio Arquivístico Digital Preservar para garantir o acesso Considerando que a informação arquivística, produzida, recebida, utilizada e conservada em sistemas informatizados,

Leia mais

Prémio Nobel para os brócolos

Prémio Nobel para os brócolos Prémio Nobel para os brócolos Em 2009 o Prémio Nobel da Química foi atribuído a três cientistas pela descoberta de que uma estrutura da célula chamada ribossoma é muito parecida com um molho de brócolos.

Leia mais

Identificar os reagentes, produtos e processos básicos da fotossíntese e da respiração celular.

Identificar os reagentes, produtos e processos básicos da fotossíntese e da respiração celular. 1 D1 (B) Identificar os reagentes, produtos e processos básicos da fotossíntese e da respiração celular. D2 (b) Explicar a inter-relação entre fotossíntese e respiração celular nas células dos organismos

Leia mais

6. Geometria, Primitivas e Transformações 3D

6. Geometria, Primitivas e Transformações 3D 6. Geometria, Primitivas e Transformações 3D Até agora estudamos e implementamos um conjunto de ferramentas básicas que nos permitem modelar, ou representar objetos bi-dimensionais em um sistema também

Leia mais

Como Montar Modelos de Estruturas Metálicas a Partir do Empacotamento de Esferas de Isopor

Como Montar Modelos de Estruturas Metálicas a Partir do Empacotamento de Esferas de Isopor Como Montar Modelos de Estruturas Metálicas a Partir do Empacotamento de Esferas de Isopor Luiz Antonio Andrade de Oliveira Camila Silveira da Silva Olga Maria Mascarenhas de Faria Oliveira COMO COLAR

Leia mais

GPS (Global Positioning System) Sistema de Posicionamento Global

GPS (Global Positioning System) Sistema de Posicionamento Global GPS (Global Positioning System) Sistema de Posicionamento Global 1 Sistema de Posicionamento Global é um sistema de posicionamento por satélite que permite posicionar um corpo que se encontre à superfície

Leia mais

Capítulo 9. Versão 0.6. Domínios, motivos proteicos e evolução por rearranjo de éxons. 1.- Domínios proteicos

Capítulo 9. Versão 0.6. Domínios, motivos proteicos e evolução por rearranjo de éxons. 1.- Domínios proteicos Capítulo 9 Versão 0.6 Domínios, motivos proteicos e evolução por rearranjo de éxons 1.- Domínios proteicos Domínios de proteínas são unidades estruturais, funcionais e evolutivas das proteínas. Um domínio

Leia mais

Universidade Federal de Pelotas Faculdade de Agronomia Eliseu Maciel Programa de Pós-Graduação em Agronomia CENTRO DE GENOMICA E FITOMELHORAMENTO

Universidade Federal de Pelotas Faculdade de Agronomia Eliseu Maciel Programa de Pós-Graduação em Agronomia CENTRO DE GENOMICA E FITOMELHORAMENTO Universidade Federal de Pelotas Faculdade de Agronomia Eliseu Maciel Programa de Pós-Graduação em Agronomia CENTRO DE GENOMICA E FITOMELHORAMENTO Introdução à Bioinformática Professores: Luciano Maia Antonio

Leia mais

Estudo de Casos 57. 5.1. Estudo de Caso 1: Velocidade Intervalar e Espessura da Camada

Estudo de Casos 57. 5.1. Estudo de Caso 1: Velocidade Intervalar e Espessura da Camada Estudo de Casos 57 5 Estudo de Casos Neste capítulo são relatados três estudos de caso com sismogramas de referência sintéticos que têm como objetivo avaliar o modelo proposto. Na descrição dos estudos

Leia mais

Comunicado Técnico. Análise Preliminar de um Processo para Identificação e Alinhamento de Seqüências Homólogas para Proteínas com Estrutura Resolvida

Comunicado Técnico. Análise Preliminar de um Processo para Identificação e Alinhamento de Seqüências Homólogas para Proteínas com Estrutura Resolvida Comunicado Técnico Setembro, 48 2003 Campinas, SP ISSN 1677-8464 Análise Preliminar de um Processo para Identificação e Alinhamento de Seqüências Homólogas para Proteínas com Roberto Hiroshi Higa 1 Paula

Leia mais

Regressão simbólica sobre séries temporais de dados meteorológicos utilizando programação genética

Regressão simbólica sobre séries temporais de dados meteorológicos utilizando programação genética Regressão simbólica sobre séries temporais de dados meteorológicos utilizando programação genética Programa de Pós-Graduação em Computação Aplicada Departamento de Informática Universidade Tecnológica

Leia mais

APROFUNDAMENTO DE QUIMICA ORGÂNICA LISTA 04 09/10/2014. Assunto: Estudo das Funções Orgânicas

APROFUNDAMENTO DE QUIMICA ORGÂNICA LISTA 04 09/10/2014. Assunto: Estudo das Funções Orgânicas APROFUNDAMENTO DE QUIMICA ORGÂNICA LISTA 04 09/10/2014 Assunto: Estudo das Funções Orgânicas 01-( Medicina Jundiaí 2014 ) Considere as fórmulas estruturais de substâncias utilizadas como antibióticos:

Leia mais

QUÍMICA FARMACÊUTICA I

QUÍMICA FARMACÊUTICA I PROTÓTIPO QUÍMICA FARMACÊUTICA I AULA 5 Primeiro tipo ou exemplar original, modelo. Diz-se do composto originalmente identificado que apresenta atividade farmacológica in vivo. Profa. Ms. Paula Cristina

Leia mais

Resolução. = a = 700 cm = 7m; = b = 400 cm = 4 m; perímetro = 2 (7 + 4) = 22; 14 x 22 = 308; área = 7 x 4 = 28; 20 x 28 = 560; 308 + 560 = 868

Resolução. = a = 700 cm = 7m; = b = 400 cm = 4 m; perímetro = 2 (7 + 4) = 22; 14 x 22 = 308; área = 7 x 4 = 28; 20 x 28 = 560; 308 + 560 = 868 1 A figura abaixo é uma representação plana de certo apartamento, feita na escala 1: 00, ou seja, 1 cm na representação plana corresponde a 00 cm na realidade. Vão ser colocados rodapé e carpete no salão.

Leia mais

Regulação do metabolismo do glicogênio

Regulação do metabolismo do glicogênio Regulação do metabolismo do glicogênio A U L A 27 objetivos Ao final desta aula, você deverá ser capaz de: Aprender sobre as vias de regulação do metabolismo de glicogênio. Reforçar os conceitos adquiridos

Leia mais

ALGORITMOS DE ORDENAÇÃO. Algoritmos de comparação-e-troca. Bubble Sort Merge Sort Quick Sort

ALGORITMOS DE ORDENAÇÃO. Algoritmos de comparação-e-troca. Bubble Sort Merge Sort Quick Sort ALGORITMOS DE ORDENAÇÃO ALGORITMOS DE ORDENAÇÃO Algoritmos de comparação-e-troca Bubble Sort Merge Sort Quick Sort 1 BUBBLE SORT Usa a estratégia de comparação-e-troca É constituído por várias fases Cada

Leia mais

PROCESSO SELETIVO SIMPLIFICADO Nº 33 /2012

PROCESSO SELETIVO SIMPLIFICADO Nº 33 /2012 MINISTÉRIO DA EDUCAÇÃO UNIVERSIDADE FEDERAL DO PIAUÍ CENTRO DE EDUCAÇÃO ABERTA E A DISTÂNCIA CEAD UNIVERSIDADE ABERTA DO BRASIL/CAPES COORDENAÇÃO DO CURSO DE PEDAGOGIA / EAD Rua Olavo Bilac, 1148 Centro

Leia mais

Sequenciamento de genomas

Sequenciamento de genomas Sequenciamento de genomas 1 o genoma completo vírus OX174 5.000 nt (Sanger et al. 1977) em 1977 1000 pb sequenciados por ano neste ritmo genoma E. coli K-12 4.6-Mbp levaria mais de 1000 anos para ser completo

Leia mais

CAP. I ERROS EM CÁLCULO NUMÉRICO

CAP. I ERROS EM CÁLCULO NUMÉRICO CAP. I ERROS EM CÁLCULO NUMÉRICO 0. Introdução Por método numérico entende-se um método para calcular a solução de um problema realizando apenas uma sequência finita de operações aritméticas. A obtenção

Leia mais

Radioatividade. Por Marco César Prado Soares Engenharia Química Universidade Estadual de Campinas - UNICAMP 2013

Radioatividade. Por Marco César Prado Soares Engenharia Química Universidade Estadual de Campinas - UNICAMP 2013 Radioatividade Por Marco César Prado Soares Engenharia Química Universidade Estadual de Campinas - UNICAMP 2013 Dados históricos: Descoberta por Henri Becquerel. Em 1903, Rutherford e Frederick Soddy propuseram

Leia mais

DO GENE À PROTEÍNA ALGUNS CONCEITOS BASICOS COMO SE ORGANIZAM OS NUCLEÓTIDOS PARA FORMAR O DNA?

DO GENE À PROTEÍNA ALGUNS CONCEITOS BASICOS COMO SE ORGANIZAM OS NUCLEÓTIDOS PARA FORMAR O DNA? DO GENE À PROTEÍNA O processo de formação das proteínas no ser humano pode ser difícil de compreender e inclui palavras e conceitos que possivelmente nos são desconhecidos. Assim, vamos tentar explicar

Leia mais

Ivonildo Almeida dos Santos 1 ; Manoelito Coelho dos Santos Junior 2. PALAVRAS-CHAVE:vassoura-de-bruxa,pirofosforilase,M. perniciosa.

Ivonildo Almeida dos Santos 1 ; Manoelito Coelho dos Santos Junior 2. PALAVRAS-CHAVE:vassoura-de-bruxa,pirofosforilase,M. perniciosa. 1306 DESENVOLVIMENTO DE UM BANCO DE DADOS COM ESTRUTURAS QUÍMICAS DERIVADAS DO SEMI-ÁRIDO BAIANO, PARA PESQUISA DE POSSÍVEIS INIBIDORES DA ENZIMA DO FUNGOMONILIOPHTHORA PERNICIOSA TRIAGEM VIRTUAL Ivonildo

Leia mais

CONHECIMENTOS ESPECÍFICOS

CONHECIMENTOS ESPECÍFICOS Acerca da bioinformática em geral, julgue os itens subsequentes. 41 A bioinformática pode ser definida como uma área multidisciplinar que envolve principalmente a Biologia, a Ciência da Computação, a Matemática

Leia mais

O fluxo da informação é unidirecional

O fluxo da informação é unidirecional Curso - Psicologia Disciplina: Genética Humana e Evolução Resumo Aula 3- Transcrição e Tradução Dogma central TRANSCRIÇÃO DO DNA O fluxo da informação é unidirecional Processo pelo qual uma molécula de

Leia mais

ESCOLA SECUNDÁRIA DE CASQUILHOS

ESCOLA SECUNDÁRIA DE CASQUILHOS ESCOLA SECUNDÁRIA DE CASQUILHOS 1.º Teste sumativo de FQA 21. Out. 2015 Versão 1 10.º Ano Turma A e B Professora: Duração da prova: 90 minutos. Este teste é constituído por 9 páginas e termina na palavra

Leia mais

O nosso trabalho. Desenvolver um sistema útil e robusto para aplicação em ambiente industrial/laboratorial. Objectivo

O nosso trabalho. Desenvolver um sistema útil e robusto para aplicação em ambiente industrial/laboratorial. Objectivo O nosso trabalho Objectivo Desenvolver um sistema útil e robusto para aplicação em ambiente industrial/laboratorial Estratégia Iniciar a investigação com um problema simples e fazer uma aproximação progressiva

Leia mais

Pesquisador em Saúde Pública Prova Discursiva INSTRUÇÕES

Pesquisador em Saúde Pública Prova Discursiva INSTRUÇÕES Bioinformática Pesquisador em Saúde Pública Prova Discursiva 1. Você recebeu do fiscal o seguinte material: INSTRUÇÕES a) Este Caderno de Questões contendo o enunciado das 2 (duas) questões da prova discursiva.

Leia mais

Profª. Angela A. de Souza DESENHO DE ESTRUTURAS

Profª. Angela A. de Souza DESENHO DE ESTRUTURAS DESENHO DE ESTRUTURAS INTRODUÇÃO A estrutura de concreto armado é resultado da combinação entre o concreto e o aço. Porém, para a sua execução, não é suficiente apenas a presença desses dois materiais;

Leia mais

Pesquisador em Saúde Pública Prova Discursiva INSTRUÇÕES

Pesquisador em Saúde Pública Prova Discursiva INSTRUÇÕES Biologia computacional Pesquisador em Saúde Pública Prova Discursiva 1. Você recebeu do fiscal o seguinte material: INSTRUÇÕES a) Este Caderno de Questões contendo o enunciado das 2 (duas) questões da

Leia mais

Universidade Federal de São Paulo Campus São José dos Campos LISTA DE DISCIPLINAS DA GRADUAÇÃO

Universidade Federal de São Paulo Campus São José dos Campos LISTA DE DISCIPLINAS DA GRADUAÇÃO A B C Álgebra Linear Álgebra Linear Computacional Álgebra Linear II Algoritmos e Estrutura de Dados I Algoritmos e Estrutura de Dados II Algoritmos em Bioinformática Alteridade e Diversidade no Brasil

Leia mais

1. (Unesp) A ilustração apresenta o resultado de um teste de paternidade obtido pelo método do DNA-Fingerprint, ou "impressão digital de DNA".

1. (Unesp) A ilustração apresenta o resultado de um teste de paternidade obtido pelo método do DNA-Fingerprint, ou impressão digital de DNA. Ácidos Nuclêicos 1. (Unesp) A ilustração apresenta o resultado de um teste de paternidade obtido pelo método do DNA-Fingerprint, ou "impressão digital de DNA". a) Segundo o resultado acima, qual dos homens,

Leia mais

Redes Neurais Construtivas. Germano Crispim Vasconcelos Centro de Informática - UFPE

Redes Neurais Construtivas. Germano Crispim Vasconcelos Centro de Informática - UFPE Redes Neurais Construtivas Germano Crispim Vasconcelos Centro de Informática - UFPE Motivações Redes Feedforward têm sido bastante utilizadas em aplicações de Reconhecimento de Padrões Problemas apresentados

Leia mais

Comunicado Técnico ISSN 1677-8464

Comunicado Técnico ISSN 1677-8464 Ministério da Agricultura, Pecuária e Abastecimento Comunicado Técnico Novembro, 24 2002 Campinas, SP ISSN 1677-8464 Utilização do Software GRASP para gerar Arquivo de Coordenadas com Valores de Potencial

Leia mais

Modelagem de Circuitos Digitais

Modelagem de Circuitos Digitais 1 Modelagem de Circuitos Digitais Para modelar um circuito digital para realizar uma determinada operação: Analisar problema Identificar sinais de entrada do circuito Identificar sinais de saída do circuito

Leia mais

BIOLOGIA MOLECULAR. Prof. Dr. José Luis da C. Silva

BIOLOGIA MOLECULAR. Prof. Dr. José Luis da C. Silva BIOLOGIA MOLECULAR Prof. Dr. José Luis da C. Silva BIOLOGIA MOLECULAR A Biologia Molecular é o estudo da Biologia em nível molecular, com especial foco no estudo da estrutura e função do material genético

Leia mais

Versão 0.3 Capítulo 5. Bancos de dados. Estrutura e modelos de dados

Versão 0.3 Capítulo 5. Bancos de dados. Estrutura e modelos de dados Versão 0.3 Capítulo 5 Bancos de dados Estrutura e modelos de dados Banco de dados, em uma definição geral, é uma coleção dados inter-relacionados que representa algum aspecto do mundo real ou um subconjunto

Leia mais

Modelagem e Simulação Material 02 Projeto de Simulação

Modelagem e Simulação Material 02 Projeto de Simulação Modelagem e Simulação Material 02 Projeto de Simulação Prof. Simão Sirineo Toscani Projeto de Simulação Revisão de conceitos básicos Processo de simulação Etapas de projeto Cuidados nos projetos de simulação

Leia mais

Arranjos Atômicos 26/3/2006 CM I 1

Arranjos Atômicos 26/3/2006 CM I 1 Arranjos Atômicos 26/3/2006 CM I 1 26/3/2006 CM I 2 Arranjo Periódico de Átomos Sólido: constituído por átomos (ou grupo de átomos) que se distribuem de acordo com um ordenamento bem definido; Esta regularidade:»

Leia mais

Hoje estudaremos a bioquímica dos ácidos nucléicos. Acompanhe!

Hoje estudaremos a bioquímica dos ácidos nucléicos. Acompanhe! Aula: 2 Temática: Ácidos Nucléicos Hoje estudaremos a bioquímica dos ácidos nucléicos. Acompanhe! Introdução: Os ácidos nucléicos são as moléculas com a função de armazenamento e expressão da informação

Leia mais

Função de Proteínas: Mioglobina e Hemoglobina

Função de Proteínas: Mioglobina e Hemoglobina Aula de Bioquímica I Tema: Função de Proteínas: Mioglobina e Hemoglobina Prof. Dr. Júlio César Borges Depto. de Química e Física Molecular DQFM Instituto de Química de São Carlos IQSC Universidade de São

Leia mais