Bases Moleculares da Obesidade e Diabetes. Hormônios e Diabetes

Tamanho: px
Começar a partir da página:

Download "Bases Moleculares da Obesidade e Diabetes. Hormônios e Diabetes"

Transcrição

1 Bases Moleculares da Obesidade e Diabetes Hormônios e Diabetes Prof. Carlos Castilho de Barros

2 SISTEMA ENDÓCRINO CONSISTE EM 1) Glândulas e células específicas, 2) Mensageiros químicos chamados Hormônios 3) Um órgão-alvo ou receptor.

3 As glândulas são classificadas em: Exócrina Endócrinas:

4 Hormônios (hormon = urgência) São moléculas sinalizadoras que regulam e coordenam várias funções biológicas no organismo. São substâncias químicas secretadas por uma célula ou grupo de células no sangue ou fluído extra celular, e que vão agir em um ou mais alvos, que podem estar próximos ou distantes, e onde exercem seus efeitos em baixíssimas concentrações

5 Quanto ao local de ação a atividade dos hormônios é classificada como: 1- Endócrina : alcança alvos distantes através da corrente sanguínea 2- Parácrina: atua em células ou tecidos vizinhos 3- Autócrina: age no próprio tecido ou células onde foi produzido.

6 SISTEMA NERVOSO SISTEMA ENDÓCRINO FUNÇÕES CORPORAIS

7 Hormônios produzidos em tecidos Periféricos Aparelho digestivo - estômago: gastrina grelina duodeno: Colicistocinina (CCK) Gastric inhibitory polypeptide (GIP) secretina motilina VIP íleo: enteroglucagon, Glucagon-like peptide-1 (GLP-1) fígado/outros: IGF (IGF-1, IGF-2) Tecido adiposo: leptina adiponectina resistina visfatina Ossos: osteocalcina Rim: JGA (renina) células peritubulares (eritropoietina - EPO) calcitriol prostaglandina Coração: peptídeo natriurético (atrial-anp cerebral- BNP) Músculo esquelético: irisina

8 S. NERVOSO S. Endócrino AGE RAPIDAMENTE AGE MAIS LENTAMENTE EFEITOS LOCALIZADOS E DE CURTA DURAÇÃO EFEITOS GERAIS E DE LONGA DURAÇÃO

9 HORMÔNIOS Os processos corporais geralmente estão sob controle hormonal " Controlam velocidade das reações enzimáticas " Controlam a expressão gênica e síntese de proteínas " Controlam o transporte das membranas plasmáticas através de segundos mensageiros " Induzem a atividade secretória

10 HORMÔNIOS Químicamente podem ser divididos em três classes (vertebrados): Hormônios peptídicos e proteicos: ex.: Peptídeos: TRH e vasopressina; Proteínas: insulina e hormônio do crescimento; Glicoproteínas: Hormônio luteinizante, hormônio folículoestimulante e hormônio estimulante da tireóide. Hormônios derivados de lípidos e fosfolípidos: principais são os hormônios esteróides que derivam de colesterol e os eicosanóides. Ex.: esteroides: testosterona e cortisol; Eicosanoides: prostaglandinas. Monoaminas derivados de aminoácidos aromáticos como fenilalanina, tirosina, triptofano; Ex.: adrenalina, noradrenalina; dopamina, serotonina, T3 e T4.

11 Derivados da tirosina Adrenalina Dopamina Noradrenalina Tiroxina (t4) Triiodotironina (t3) Derivados do triptofano Melatonina Serotonona

12 Esteróides Aldosterona Cortisol Estradiol Progesterona Testosterona Vitamina D

13 Peptideos Angiotensina Bradicinina Hormonio melanócito-estimulante Ocitocina Somatostatina Hormonio liberador de tireotrofina Vasopressina

14 Proteínas Adrenocorticotrofina (ACTH) Polipeptídeo pancreático Hormônio foliculo-estimulante (FSH) Hormônio liberador de gonadotrofinas (GnRH) Glucagon Fatores de crescimento semelhantes a insulina (IGFI, IGFII) Insulina Hormonio luteinizante (LH) Prolactina Hormônio paratireoideo (PTH) Hormônio do crescimento (GH) Somatotiberina (GHRH) Tireotrofina (TSH)

15

16

17 Célula Delta Célula Alfa α glucagon β insulina δ somatostatina Capilares Célula Beta PP polipeptídeo pancreático

18 Células β

19

20

21

22

23

24

25

26

27

28

29 Insulina e Sinalização

30

31 Seqüência do Receptor de Insulina Humano MGTGGRRGAAAAPLLVAVAALLLGAAGHLYPGEVCPGMDIRNNLTRLHELENCSVIEGHLQILLMFKTRPEDFR DLSFPKLIMITDYLLLFRVYGLESLKDLFPNLTVIRGSRLFFNYALVIFEMVHLKELGLYNLMNITRGSVRIEKNNEL CYLATIDWSRILDSVEDNYIVLNKDDNEECGDICPGTAKGKTNCPATVINGQFVERCWTHSHCQKVCPTICKSHG CTAEGLCCHSECLGNCSQPDDPTKCVACRNFYLDGRCVETCPPPYYHFQDWRCVNFSFCQDLHHKCKNSRR QGCHQYVIHNNKCIPECPSGYTMNSSNLLCTPCLGPCPKVCHLLEGEKTIDSVTSAQELRGCTVINGSLIINIRGG NNLAAELEANLGLIEEISGYLKIRRSALVSLSFFRKLRLIRGETLEIGNYSFYALDNQNLRQLWDWSKHNLTTTQG KLFFHYNPKLCLSEIHKMEEVSGTKGRQERNDIALKTNGDKASCENELLKFSYIRTSFDKILLRWEPYWPPDFRD LLGFMLFYKEAPYQNVTEFDGQDACGSNSWTVVDIDPPLRSNDPKSQNHPGWLMRGLKPWTQYAIFVKTLVTF SDERRTYGAKSDIIYVQTDATNPSVPLDPISVSNSSSQIILKWKPPSDPNGNITHYLVFWERQAEDSELFELDYCL KGLKLPSRTWSPPFESEDSQKHNQSEYEDSAGECCSCPKTDSQILKELEESSFRKTFEDYLHNVVFVPRKTSS GTGAEDPRPSRKRRSLGDVGNVTVAVPTVAAFPNTSSTSVPTSPEEHRPFEKVVNKESLVISGLRHFTGYRIEL QACNQDTPEERCSVAAYVSARTMPEAKADDIVGPVTHEIFENNVVHLMWQEPKEPNGLIVLYEVSYRRYGDEE LHLCVSRKHFALERGCRLRGLSPGNYSVRIRATSLAGNGSWTEPTYFYVTDYLDVPSNIAKIIIGPLIFVFLFSVVI GSIYLFLRKRQPDGPLGPLYASSNPEYLSASDVFPCSVYVPDEWEVSREKITLLRELGQGSFGMVYEGNAR DIIKGEAETRVAVKTVNESASLRERIEFLNEASVMKGFTCHHVVRLLGVVSKGQPTLVVMELMAHGDLKSYLRSL RPEAENNPGRPPPTLQEMIQMAAEIADGMAYLNAKKFVHRDLAARNCMVAHDFTVKIGDFGMTRDIYETDYYR KGGKGLLPVRWMAPESLKDGVFTTSSDMWSFGVVLWEITSLAEQPYQGLSNEQVLKFVMDGGYLDQPDNCPE RVTDLMRMCWQFNPKMRPTFLEIVNLLKDDLHPSFPEVSFFHSEENKAPESEELEMEFEDMENVPLDRSSHCQ REEAGGRDGGSSLGFKRSYEEHIPYTHMNGGKKNGRILTLPRSNPS

32 Transcrição Atividade tirosinaquinase Subunidade α Subunidade β Glicogênio Fosforilação

33 Glicose

34

35 Insulina e Metabolismo

36

37

38

39 Ácidos graxos

40 Glicogênio sintase Glicogênio fosforilase Glicoquinase Glicose6 fosfatase Frutose1,6-bisfosfatase Fosfofruto -quinase Fosfoenolpiruvatocarboxi-quinase Piruvato quinase Acetil-CoA carboxilase

41

42 DIABETES Mellitus Insulino-dependente (IDDM) Tipo I Não insulino-dependente (NIDDM) Tipo II -Normalmente acomete pessoas < 20 anos -Peso Normal -Produção de anticorpos contra as ilhotas - Inicia-se com uma insulite - Presença de atrofia e destruição das células beta -Normalmente acomete pessoas >30 anos -Obesos -Não apresentam insulite -Pequena diminuição das células beta - Diminuição dos receptores de insulina e de sua sinalização

Disciplina: Bioquímica Curso: Análises Clínicas 3º. Módulo Docente: Profa. Dra. Marilanda Ferreira Bellini

Disciplina: Bioquímica Curso: Análises Clínicas 3º. Módulo Docente: Profa. Dra. Marilanda Ferreira Bellini Disciplina: Bioquímica Curso: Análises Clínicas 3º. Módulo Docente: Profa. Dra. Marilanda Ferreira Bellini Do grego: Hormon = estimular Hormônios são substâncias químicas produzidas por um grupo de células

Leia mais

SISTEMA ENDÓCRINO Órgãos endócrinos e suas secreções, alvos e efeitos principais

SISTEMA ENDÓCRINO Órgãos endócrinos e suas secreções, alvos e efeitos principais LOCALIZAÇÃO SISTEMA ENDÓCRINO Órgãos endócrinos e suas secreções, alvos e efeitos principais TIPO QUÍMICO HORMÔNIO ALVO EFEITOS PRINCIPAIS Glândula pineal Glândula Amina Melatonina Desconhecido Controla

Leia mais

Fisiologia do Sistema Endócrino. Introdução e Conceitos Gerais. Profa. Dra. Rosângela F. Garcia

Fisiologia do Sistema Endócrino. Introdução e Conceitos Gerais. Profa. Dra. Rosângela F. Garcia Fisiologia do Sistema Endócrino Introdução e Conceitos Gerais Profa. Dra. Rosângela F. Garcia SISTEMA ENDÓCRINO 1- INTRODUÇÃO SISTEMA DE CONTROLE HOMEOSTASE MENSAGEIROS HORMÔNIOS *não formam um sistema

Leia mais

Hormônios do pâncreas. Insulina. Glucagon. Somatostatina. Peptídeos pancreáticos

Hormônios do pâncreas. Insulina. Glucagon. Somatostatina. Peptídeos pancreáticos Endocrinologia do Pâncreas! O pâncreas como um órgão endócrino Importante papel na absorção, distribuição e armazenamento de vários substratos energéticos Hormônios do pâncreas Insulina Glucagon Somatostatina

Leia mais

CARACTERÍSTICAS GERAIS DOS HORMÔNIOS: ESTRUTURA E MECANISMOS DE AÇÃO. Insulina

CARACTERÍSTICAS GERAIS DOS HORMÔNIOS: ESTRUTURA E MECANISMOS DE AÇÃO. Insulina CARACTERÍSTICAS GERAIS DOS HORMÔNIOS: ESTRUTURA E MECANISMOS DE AÇÃO ADH Prolactina Adrenalina Testosterona Insulina CONSIDERAÇÕES GERAIS SOBRE O SISTEMA ENDÓCRINO O sistema endócrino é constituído por

Leia mais

Pâncreas Endócrino. Prof. Dr. Luiz Carlos C. Navegantes. Ramal: 4635

Pâncreas Endócrino. Prof. Dr. Luiz Carlos C. Navegantes. Ramal: 4635 Pâncreas Endócrino Prof. Dr. Luiz Carlos C. Navegantes navegantes@fmrp.usp.br Ramal: 4635 O diabetes mellitus É uma síndrome decorrente da falta de insulina ou da incapacidade de a insulina de exercer

Leia mais

Regulação hormonal 15/11/2018. Regulação hormonal. Glândula pineal

Regulação hormonal 15/11/2018. Regulação hormonal. Glândula pineal Regulação hormonal Regulação hormonal Sistema endócrino Manutenção da homeostasia Hormônios Substâncias (proteicas ou lipídicas) transportadas pelos sangue até as células ou tecido- alvo; Especificidade;

Leia mais

Fisiologia do Sistema Endócrino

Fisiologia do Sistema Endócrino Fisiologia do Sistema Endócrino Hormônios hipofisários anteriores Hormônios hipotalâmicos: Hormônio liberador de gonadotrofinas (GnRH) Hormônio liberador de tireotrofina (TRH) Hormônio liberador de corticotrofina

Leia mais

SISTEMA ENDÓCRINO. Prof.ª Leticia Pedroso

SISTEMA ENDÓCRINO. Prof.ª Leticia Pedroso SISTEMA ENDÓCRINO Prof.ª Leticia Pedroso Sistema Endócrino Existem no nosso organismo várias glândulas endócrinas (produzir e secretar hormônios para dentro do sangue). Hormônios: substâncias químicas

Leia mais

Comunicação e sinalização celular

Comunicação e sinalização celular Comunicação e sinalização celular ------------------------------------------------------------------------------------- Do simples para o complexo, moléculas organizadas formam as células, que unidas formam

Leia mais

Aula de Bioquímica I. Tema: Hormônios. Prof. Dr. Júlio César Borges

Aula de Bioquímica I. Tema: Hormônios. Prof. Dr. Júlio César Borges Aula de Bioquímica I Tema: Hormônios Prof. Dr. Júlio César Borges Depto. de Química e Física Molecular DQFM Instituto de Química de São Carlos IQSC Universidade de São Paulo USP E-mail: borgesjc@iqsc.usp.br

Leia mais

AULA 02 - Eixo Hipotálamo-Hipofisário DOTS - JOGO DOS PONTOS

AULA 02 - Eixo Hipotálamo-Hipofisário DOTS - JOGO DOS PONTOS AULA 02 - Eixo Hipotálamo-Hipofisário DOTS - JOGO DOS PONTOS 1. A neuro-hipófise armazena e libera dois hormônios. Quais são estes? a) Hormônio antidiurético (ADH) e folículo estimulante (FSH) b) Prolactina

Leia mais

Glândulas endócrinas:

Glândulas endócrinas: SISTEMA ENDÓCRINO Glândulas endócrinas: Funções: Secreções de substâncias (hormônios) que atuam sobre célula alvo Regulação do organismo (homeostase) Hormônios: Substâncias químicas que são produzidas

Leia mais

GLÂNDULAS DEFINIÇÃO TIPOS DE SECREÇÕES. São um conjunto de células especializadas que têm como finalidade produzir secreções.

GLÂNDULAS DEFINIÇÃO TIPOS DE SECREÇÕES. São um conjunto de células especializadas que têm como finalidade produzir secreções. DEFINIÇÃO São um conjunto de células especializadas que têm como finalidade produzir secreções. TIPOS DE SECREÇÕES Hormônios substâncias químicas que vão atuar em locais distantes da sua fabricação, tendo

Leia mais

Sistema Endócrino. Prof. Mateus Grangeiro

Sistema Endócrino. Prof. Mateus Grangeiro Sistema Endócrino Prof. Mateus Grangeiro HORMÔNIOS Moléculas mediadoras, liberadas pelas glândulas endócrinas, capazes de conduzir determinada informação entre uma ou mais células. Natureza química variada

Leia mais

Fisiologia do Sistema Endócrino. Pâncreas Endócrino. Anatomia Microscópica. Anatomia Microscópica

Fisiologia do Sistema Endócrino. Pâncreas Endócrino. Anatomia Microscópica. Anatomia Microscópica Fisiologia do Sistema Endócrino Pâncreas Endócrino Prof. Dr. Leonardo Rigoldi Bonjardim Profa. Adjunto do Depto. De Fisiologia-CCBS-UFS Material disponível em: http://www.fisiologiaufs.xpg.com.br 2006

Leia mais

REGULAÇÃO HORMONAL DO METABOLISMO DO GLICOGÊNIO E DE LIPÍDIOS

REGULAÇÃO HORMONAL DO METABOLISMO DO GLICOGÊNIO E DE LIPÍDIOS REGULAÇÃO HORMONAL DO METABOLISMO DO GLICOGÊNIO E DE LIPÍDIOS Tiroxina Epinefrina (adrenalina) Glucagon Insulina Hormônios esteroides: Cortisol (Suprarenal) Progesterona Testosterona Estradiol Aldosterona

Leia mais

Componentes do Sistema Endócrino

Componentes do Sistema Endócrino Fisiologia 7 O sistema endócrino Iniciando a conversa Quem nunca sentiu os efeitos dos hormônios? Nesta aula, vamos conhecer um pouco mais sobre essas intrigantes moléculas, sua fabricação e seus efeitos.

Leia mais

Sistema Endócrino. Importância da endocrinologia... Introdução 17/6/2009 ROTEIRO DA AULA. Glândulas Endócrinas

Sistema Endócrino. Importância da endocrinologia... Introdução 17/6/2009 ROTEIRO DA AULA. Glândulas Endócrinas UNESP -FCAV -JABOTICABAL AGRONOMIA FISIOLOGIA DOS ANIMAIS DOMÉTICOS II Sistema Endócrino ROTEIRO DA AULA Introdução a endocrinologia Hormônios -definições, mecanismos de sinalização, química e mecanismo

Leia mais

Mecanismo de Ação Hormonal

Mecanismo de Ação Hormonal Centro de Ciências da Vida Faculdade de Ciências Biológicas Mecanismo de Ação Hormonal Prof. Dr. Alexandre Rezende Endocrinologia Comunicação dentro do nosso corpo: (1) Sistema nervoso (2) Sistema endócrino

Leia mais

Sistema endócrino é formado pelo conjunto de glândulas que apresentam como atividade característica a produção e secreções de hormônios.

Sistema endócrino é formado pelo conjunto de glândulas que apresentam como atividade característica a produção e secreções de hormônios. alexandre.personal@hotmail.com www.professoralexandrerocha.com.br Sistema endócrino é formado pelo conjunto de glândulas que apresentam como atividade característica a produção e secreções de hormônios.

Leia mais

PANCREAS A eliminação do suco pancreático é regulada, principalmente, pelo sistema nervoso. Quando uma pessoa alimenta-se, vários fatores geram

PANCREAS A eliminação do suco pancreático é regulada, principalmente, pelo sistema nervoso. Quando uma pessoa alimenta-se, vários fatores geram PANCREAS O pâncreas, uma importante glândula do corpo humano, é responsável pela produção de hormônios e enzimas digestivas. Por apresentar essa dupla função, essa estrutura pode ser considerada um órgão

Leia mais

Hormônios: receptores e ação

Hormônios: receptores e ação Curso de Atualização em Endocrinologia e Metabologia SBEM/RJ Hormônios: receptores e ação Marisa Breitenbach, MD, PhD Prof. Adjunto - UERJ Coordenadora de Pesquisa - INCA Câncer de tiroide metastático

Leia mais

Então, os hormônios são os responsáveis pela manutenção do equilíbrio e perfeito funcionamento do organismo. Qualquer variação de dosagem hormonal no

Então, os hormônios são os responsáveis pela manutenção do equilíbrio e perfeito funcionamento do organismo. Qualquer variação de dosagem hormonal no SISTEMA ENDÓCRINO Sistema Endócrino O homem apresenta em seu organismo várias glândulas endócrinas (glândulas que secretam hormônios para dentro do sangue). Hormônios são substâncias químicas que equilibram

Leia mais

Fisiologia celular I. Fisiologia Prof. Msc Brunno Macedo

Fisiologia celular I. Fisiologia Prof. Msc Brunno Macedo celular I celular I Objetivo Conhecer os aspectos relacionados a manutenção da homeostasia e sinalização celular Conteúdo Ambiente interno da célula Os meios de comunicação e sinalização As bases moleculares

Leia mais

Glândulas endócrinas:

Glândulas endócrinas: Sistema Endócrino Glândulas endócrinas: Funções: Secreções de substâncias (hormônios) que atuam sobre célula alvo Hormônios: Substâncias informacionais distribuídas pelo sangue. Eles modificam o funcionamento

Leia mais

Sistema endócrino é formado pelo conjunto de glândulas que apresentam como atividade característica a produção e secreções de hormônios.

Sistema endócrino é formado pelo conjunto de glândulas que apresentam como atividade característica a produção e secreções de hormônios. alexandre.personal@hotmail.com www.professoralexandrerocha.com.br Sistema endócrino é formado pelo conjunto de glândulas que apresentam como atividade característica a produção e secreções de hormônios.

Leia mais

Atua como um sistema de controle e regulação (juntamente com o sistema nervoso)

Atua como um sistema de controle e regulação (juntamente com o sistema nervoso) Fisiologia do Sistema Endócrino Sistema hormonal Atua como um sistema de controle e regulação (juntamente com o sistema nervoso) Os dois sistemas de controle agem de maneira integrada, garantindo a homeostasia

Leia mais

Integração. Sistema Nervoso. Glândula Endócrina. Hormônio. Órgão ou Tecido alvo

Integração. Sistema Nervoso. Glândula Endócrina. Hormônio. Órgão ou Tecido alvo Integração Sistema Nervoso Sinal Nervosa Sinal Química Glândula Endócrina Hormônio Órgão ou Tecido alvo Nível Corporal Regulação e integração de: -Balanço de íons e líquidos -Balanço de energia (metabolismo)

Leia mais

Sistema Endócrino. O que é um SISTEMA? SISTEMA 5/6/2010. Prof. Mst. Sandro de Souza CÉLULAS TECIDOS ÓRGÃOS. Disciplina: FISIOLOGIA HUMANA

Sistema Endócrino. O que é um SISTEMA? SISTEMA 5/6/2010. Prof. Mst. Sandro de Souza CÉLULAS TECIDOS ÓRGÃOS. Disciplina: FISIOLOGIA HUMANA Disciplina: FISIOLOGIA HUMANA Sistema Endócrino Prof. Mst. Sandro de Souza O que é um SISTEMA? CÉLULAS TECIDOS ÓRGÃOS SISTEMA É um grupo de Órgãos 1 Sistema Endócrino É composto de um grupo diverso de

Leia mais

Controle Hormonal do Metabolismo

Controle Hormonal do Metabolismo Homeostase Metabólica Controle Hormonal do Metabolismo Disponibilidade De substrato energético Necessidade dos tecidos Alexandre Havt Nível sanguíneo de nutrientes Nível hormonal Impulso nervoso Integração

Leia mais

Aula: Sistemas Reguladores II. Sistema Endócrino

Aula: Sistemas Reguladores II. Sistema Endócrino Aula: Sistemas Reguladores II Sistema Endócrino PROFESSOR: Brenda Braga DATA:29/05/2014 Sistema Endócrino Formado pelo conjunto de Glândulas Endócrinas Responsáveis pela secreção de hormônios. Apenas algumas

Leia mais

HORMÔNIOS DISCIPLINA: BIOQUÍMICA PROFESSOR: Dra. Selene Babboni

HORMÔNIOS DISCIPLINA: BIOQUÍMICA PROFESSOR: Dra. Selene Babboni HORMÔNIOS DISCIPLINA: BIOQUÍMICA PROFESSOR: Dra. Selene Babboni A COORDENAÇÃO DO METABOLISMO NOS MAMÍFEROS É REALIZADA PELO SISTEMA NEUROENDÓCRINO SISTEMA: LIGADO AOS PROCESSOS METABÓLICOS DE NUTRIÇÃO,

Leia mais

PERÍODO ABSORTIVO E PÓS-ABSORTIVO

PERÍODO ABSORTIVO E PÓS-ABSORTIVO PERÍODO ABSORTIVO E PÓS-ABSORTIVO HORMONAS QUE REGULAM O METABOLISMO PRINCIPAIS FONTES DE ENERGIA CELULAR VIAS METABÓLICAS DO PERIODO ABSORTIVO ALTERAÇÕES METABÓLICAS DO PERIODO PÓS-ABSORTIVO PRODUÇÃO

Leia mais

Estratégias de regulação do metabolismo. Epinefrina, glucagon e insulina

Estratégias de regulação do metabolismo. Epinefrina, glucagon e insulina Estratégias de regulação do metabolismo Epinefrina, glucagon e insulina Estratégias de regulação do metabolismo Com a participação de enzimas Aula sobre enzimas... Com a participação de hormônios como

Leia mais

O sistema endócrino também é conhecido como sistema hormonal.

O sistema endócrino também é conhecido como sistema hormonal. Sistema endócrino O sistema endócrino também é conhecido como sistema hormonal. O que são hormônios? Hormônios são moléculas químicas que atuam como mensageiros bioquímicos, controlando as atividades de

Leia mais

SISTEMA ENDÓCRINO - 1 Figuras desta aula são do livro de Silverthorn

SISTEMA ENDÓCRINO - 1 Figuras desta aula são do livro de Silverthorn SISTEMA ENDÓCRINO - 1 Figuras desta aula são do livro de Silverthorn Bernardo Baldisserotto Departamento de Fisiologia e Farmacologia Universidade Federal de Santa Maria, Brasil Sistema nervoso: usualmente

Leia mais

Pâncreas Endócrino Controle da glicemia

Pâncreas Endócrino Controle da glicemia Pâncreas Endócrino Controle da glicemia Curso de Odontologia da UEM Prof. Kellen Brunaldi Silverthorn (Cap. 22) Guyton (Cap. 78) O SNC é responsável por cerca de 50% da glicose diariamente consumida para

Leia mais

GUIA DE ESTUDOS INSULINA E GLUCAGON

GUIA DE ESTUDOS INSULINA E GLUCAGON GUIA DE ESTUDOS INSULINA E GLUCAGON 1) O pâncreas é uma glândula mista, ou seja, possui função endócrina e exócrina. Na porção endócrina, o pâncreas produz dois hormônios: a insulina e o Esses hormônios

Leia mais

GUIA DE ESTUDOS INSULINA E GLUCAGON

GUIA DE ESTUDOS INSULINA E GLUCAGON GUIA DE ESTUDOS INSULINA E GLUCAGON 1) O pâncreas é uma glândula mista, ou seja, possui função endócrina e exócrina. Na porção endócrina, o pâncreas produz dois hormônios: a insulina e o Esses hormônios

Leia mais

Importância dos processos de sinalização. Moléculas sinalizadoras (proteínas, peptídeos, aminoácidos, hormônios, gases)

Importância dos processos de sinalização. Moléculas sinalizadoras (proteínas, peptídeos, aminoácidos, hormônios, gases) Sinalização celular Importância dos processos de sinalização Seres unicelulares Seres multicelulares Moléculas sinalizadoras (proteínas, peptídeos, aminoácidos, hormônios, gases) Receptores Proteínas -

Leia mais

4/19/2007 Fisiologia Animal - Arlindo Moura 1

4/19/2007 Fisiologia Animal - Arlindo Moura 1 4/19/2007 Fisiologia Animal - Arlindo Moura 1 HIPOTALAMO Neuronios do hipotalamo sintetizam TRH (hormonio tireotrofico) Sistema portahipotalamico hipofisario TRH estimula a sintese e secreacao de TSH (hormonio

Leia mais

SISTEMA HIPOTÁLAMO- HIPOFISÁRIO

SISTEMA HIPOTÁLAMO- HIPOFISÁRIO SISTEMA HIPOTÁLAMO- HIPOFISÁRIO Localização Importância -controle de secreção de vários hormônios -controle de vários processos fisiológicos: reprodução desenvolvimento e crescimento metabolismo energético

Leia mais

Controle por retroalimentação. Controle negativo

Controle por retroalimentação. Controle negativo Controle por retroalimentação Controle negativo Controle por retroalimentação Controle positivo Parto Controle positivo Ejeção do leite Controle por retroalimentação Controle positivo Ovulação Transporte

Leia mais

Glândulas exócrinas e endócrinas

Glândulas exócrinas e endócrinas Sistema Endócrino Glândulas exócrinas e endócrinas Tipos de Glândulas Glândulas exócrinas: liberam sua secreção fora do corpo ou dentro de uma cavidade.ex: Glândulas salivares, sudoríparas, sebáceas,...

Leia mais

Princípios. Gerais da Fisiologia Endócrina. Diego Veras Wilke

Princípios. Gerais da Fisiologia Endócrina. Diego Veras Wilke Princípios Gerais da Fisiologia Endócrina Diego Veras Wilke Claude Bernard: pai da endocrinologia Endocrinologia estudo das secreções internas do organismos. Sistema Endócrino e Homeostasia: Os hormônios

Leia mais

ENDOCRINOLOGIA DA REPRODUÇÃO. Elisângela Mirapalheta Madeira Medica Veterinária, MC

ENDOCRINOLOGIA DA REPRODUÇÃO. Elisângela Mirapalheta Madeira Medica Veterinária, MC ENDOCRINOLOGIA DA REPRODUÇÃO Elisângela Mirapalheta Madeira Medica Veterinária, MC Introdução Glândulas Endócrinas Hipotálamo Hipófise Gônadas Glândula pineal Glândulas Endócrinas Hipotálamo Glândulas

Leia mais

Universidade Federal dos Vales do Jequitinhonha e Mucuri - UFVJM. Fisiologia Endócrina. O Pâncreas. Prof. Wagner de Fátima Pereira

Universidade Federal dos Vales do Jequitinhonha e Mucuri - UFVJM. Fisiologia Endócrina. O Pâncreas. Prof. Wagner de Fátima Pereira Universidade Federal dos Vales do Jequitinhonha e Mucuri - UFVJM Fisiologia Endócrina O Pâncreas Prof. Wagner de Fátima Pereira Departamento de Ciências Básicas Faculdade de Ciências Biológica e da Saúde

Leia mais

HORMÔNIOS ESTRUTURAS DIFERENTES PARA FUNÇÕES DIFERENTES

HORMÔNIOS ESTRUTURAS DIFERENTES PARA FUNÇÕES DIFERENTES Universidade Federal de Pelotas Programa de Pós-Graduação em Veterinária Disciplina de Doenças metabólicas HORMÔNIOS ESTRUTURAS DIFERENTES PARA FUNÇÕES DIFERENTES Lourdes Caruccio Hirschmann Histórico:

Leia mais

Cada célula é programada para responder a combinações específicas de moléculas sinalizadoras

Cada célula é programada para responder a combinações específicas de moléculas sinalizadoras Sinalização celular Cada célula é programada para responder a combinações específicas de moléculas sinalizadoras Etapas da Sinalização 1) Síntese e liberação da molécula sinalizadora pela célula sinalizadora

Leia mais

Regulação Hormonal. Sistema endócrino é o conjunto formado por glândulas endócrinas e exócrinas

Regulação Hormonal. Sistema endócrino é o conjunto formado por glândulas endócrinas e exócrinas Regulação Hormonal Sistema endócrino é o conjunto formado por glândulas endócrinas e exócrinas que apresentam como actividade característica a produção de secreções denominadas hormonas, que são lançados

Leia mais

SISTEMA ENDÓCRINO. Hipotálamo Paratireóide

SISTEMA ENDÓCRINO. Hipotálamo Paratireóide INTRODUÇÃO O sistema endócrino é composto por um grupo de tecidos especializados chamados glândulas cuja função é produzir e liberar na corrente sanguínea substâncias chamadas s. Os hormônios são transportados

Leia mais

UNIVERSIDADE FEDERAL DE PERNAMBUCO CENTRO DE CIÊNCIAS BIOLÓGICAS DEPARTAMENTO DE BIOQUÍMICA HORMÔNIOS E REGULAÇÃO METABÓLICA

UNIVERSIDADE FEDERAL DE PERNAMBUCO CENTRO DE CIÊNCIAS BIOLÓGICAS DEPARTAMENTO DE BIOQUÍMICA HORMÔNIOS E REGULAÇÃO METABÓLICA UNIVERSIDADE FEDERAL DE PERNAMBUCO CENTRO DE CIÊNCIAS BIOLÓGICAS DEPARTAMENTO DE BIOQUÍMICA HORMÔNIOS E REGULAÇÃO METABÓLICA Prof a. Dr a. Nereide Magalhães Recife, fevereiro de 2005 MECANISMOS DE AÇÃO

Leia mais

SUMÁRIO Aula 9: Eixo hipotálamo-hipófise

SUMÁRIO Aula 9: Eixo hipotálamo-hipófise SUMÁRIO Aula 9: Eixo hipotálamo-hipófise 9.1 Introdução: o hipotálamo e a glândula hipófise 9.2 Hipófise posterior (neuro-hipófise) 9.3 Hipófise anterior (adeno-hipófise) 9.1 Introdução: o hipotálamo e

Leia mais

Sistema endócrino. Epitélio glandular. Funcionalmente:

Sistema endócrino. Epitélio glandular. Funcionalmente: Sistema endócrino Epitélio glandular Endócrina: secreção de hormônios diretamente no sangue Exócrina: secreção de seus produtos em ductos Funcionalmente: Merócrinas Apócrinas Holócrinas Unicelulares (Células

Leia mais

café da manhã almoço lanche da tarde jantar sono noturno fase catabólica fase anabólica

café da manhã almoço lanche da tarde jantar sono noturno fase catabólica fase anabólica O papel dos hormônios no controle do metabolismo intermediário As fases do Metabolismo energético: Fase anabólica e catabólica café da manhã almoço lanche da tarde jantar sono noturno fase catabólica fase

Leia mais

Fisiologia Animal sistema endócrino

Fisiologia Animal sistema endócrino Fisiologia Animal sistema endócrino Biologia Frente 2 Aulas 55 a 60 Diler Inspire-se Quem define a hora do nascimento? Inspire-se O que faz a mãe produzir leite e amamentar? Inspire-se Como nos tornamos

Leia mais

Epinefrina, glucagon e insulina. Hormônios com papéis fundamentais na regulação do metabolismo

Epinefrina, glucagon e insulina. Hormônios com papéis fundamentais na regulação do metabolismo Epinefrina, glucagon e insulina Hormônios com papéis fundamentais na regulação do metabolismo Epinefrina ou adrenalina Estímulos para a secreção de epinefrina: Perigos reais ou imaginários Exercício físico

Leia mais

APOSTILA DE EXERCÍCIO FÍSICO E SISTEMA ENDÓCRINO

APOSTILA DE EXERCÍCIO FÍSICO E SISTEMA ENDÓCRINO Pós-Graduação em Fisiologia do Exercício APOSTILA DE EXERCÍCIO FÍSICO E SISTEMA ENDÓCRINO Prof. Ms. Juliano Casonatto Tupã SP 2011 Introdução Visão geral do sistema endócrino: Juntamente com o sistema

Leia mais

UNIVERSIDADE ESTADUAL DA BAHIA - UNEB DEPARTAMENTO DE CIÊNCIAS DA VIDA DCV CCS006 - BIOLOGIA CELULAR. Sinalização Celular SALVADOR - BA 2016

UNIVERSIDADE ESTADUAL DA BAHIA - UNEB DEPARTAMENTO DE CIÊNCIAS DA VIDA DCV CCS006 - BIOLOGIA CELULAR. Sinalização Celular SALVADOR - BA 2016 UNIVERSIDADE ESTADUAL DA BAHIA - UNEB DEPARTAMENTO DE CIÊNCIAS DA VIDA DCV CCS006 - BIOLOGIA CELULAR Sinalização Celular PROFª POLYANNA CARÔZO DE OLIVEIRA SALVADOR - BA 2016 Introdução Evolução da multicelularidade

Leia mais

Universidade Federal de Pelotas CDTec - Graduação em Biotecnologia Disciplina de Biologia Celular. Comunicação Celular. Priscila M. M.

Universidade Federal de Pelotas CDTec - Graduação em Biotecnologia Disciplina de Biologia Celular. Comunicação Celular. Priscila M. M. Universidade Federal de Pelotas CDTec - Graduação em Biotecnologia Disciplina de Biologia Celular Comunicação Celular Priscila M. M. de Leon Dr a., Médica Veterinária PNDP Biotecnologia/UFPel Julho, 2013

Leia mais

TECIDO ADIPOSO. Prof a. Marta G. Amaral, Dra. Histofisiologia

TECIDO ADIPOSO. Prof a. Marta G. Amaral, Dra. Histofisiologia TECIDO ADIPOSO Prof a. Marta G. Amaral, Dra. Histofisiologia ORIGEM ORIGEM ATUAL expressão do gene UPC1 Só as células que expressam o receptor gama peroxissômico ativado para proliferação (PPAγ) irão se

Leia mais

O pâncreas é constituído por dois tipos principais de tecidos: (1) os ácinos, que secretam sucos digestivos no duodeno, e (2) as ilhotas de

O pâncreas é constituído por dois tipos principais de tecidos: (1) os ácinos, que secretam sucos digestivos no duodeno, e (2) as ilhotas de 1 2 3 O pâncreas é constituído por dois tipos principais de tecidos: (1) os ácinos, que secretam sucos digestivos no duodeno, e (2) as ilhotas de Langerhans, que secretam insulina, glucagon e somatostatina

Leia mais

RESUMO: SISTEMA ENDÓCRINO

RESUMO: SISTEMA ENDÓCRINO RESUMO: SISTEMA ENDÓCRINO Boa parte do funcionamento de nosso corpo depende da comunicação entre as células por meio mensageiros químicos (hormônios) que viajam pelo sangue: Os hormônios (do grego Hormon

Leia mais

Características Metabólicas dos Diferentes Tecidos Metabolismo de Estados Patológicos

Características Metabólicas dos Diferentes Tecidos Metabolismo de Estados Patológicos Características Metabólicas dos Diferentes Tecidos Metabolismo de Estados Patológicos 1 Pâncreas - Função exócrina: Secreção de enzimas líticas - Função endócrina (ilhotas): secreção de insulina e glucagon

Leia mais

BIOLOGIA. Identidade dos Seres Vivos. Sistema Endócrino Humano Parte 2. Prof.ª Daniele Duó

BIOLOGIA. Identidade dos Seres Vivos. Sistema Endócrino Humano Parte 2. Prof.ª Daniele Duó BIOLOGIA Identidade dos Seres Vivos Parte 2 https://www.qconcursos.com Prof.ª Daniele Duó Principais órgãos que constituem o sistema endócrino são: o o o o o o o Hipófise; Hipotálamo; Tireóide; Paratireóide;

Leia mais

SISTEMA NERVOSO AUTÔNOMO

SISTEMA NERVOSO AUTÔNOMO DIVISÃO DO SN SISTEMA NERVOSO AUTÔNOMO MIDRIASE E MIOSE clic Quem não tem colírio, usa óculos escuros... Raul Seixas http://www.qmc.ufsc.br/qmcweb/artigos/ma Salivação MEDO, PANICO, TERROR Reação de urgência

Leia mais

REGULAÇÃO HORMONAL DO METABOLISMO PROTEÍCO

REGULAÇÃO HORMONAL DO METABOLISMO PROTEÍCO REGULAÇÃO HORMONAL DO METABOLISMO PROTEÍCO Giovanni Resende de Oliveira giovanni@epamig.br Fonte: ROCHA,C e OLIVEIRA, R.S INTRODUÇÃO Crescimento do Animal Crescimento dos Tecidos Grau de hiperplasia e

Leia mais

Ação Hormonal no Metabolismo

Ação Hormonal no Metabolismo Ação Hormonal no Metabolismo O Metabolismo é composto por muitas reações interconectadas (reações catabólicas e anabólicas). Metabolismo de Carboidratos Complexos Metabolismo de Lipídios Complexos Metabolismo

Leia mais

FISIOLOGIA ENDÓCRINA E METABÓLICA DE PEIXES. Programa de PG em Aquicultura. Profa. Elisabeth Criscuolo Urbinati

FISIOLOGIA ENDÓCRINA E METABÓLICA DE PEIXES. Programa de PG em Aquicultura. Profa. Elisabeth Criscuolo Urbinati FISIOLOGIA ENDÓCRINA E METABÓLICA DE PEIXES Programa de PG em Aquicultura Profa. Elisabeth Criscuolo Urbinati bethurb@fcav.unesp.br Departamento de Morfologia e Fisiologia Animal 14/08 a 09/10/2017 Sinopse

Leia mais

SISTEMA ENDÓCRINO órgãos hormônios

SISTEMA ENDÓCRINO órgãos hormônios SISTEMA ENDÓCRINO Conjunto de órgãos que apresentam como atividade característica a produção de secreções denominadas hormônios, que são lançados na corrente sanguínea e irão atuar em outra parte do organismo,

Leia mais

ENDOCRINOLOGIA REPRODUTIVA. M. V. Doutorando Lucas Balinhas Farias

ENDOCRINOLOGIA REPRODUTIVA. M. V. Doutorando Lucas Balinhas Farias ENDOCRINOLOGIA REPRODUTIVA M. V. Doutorando Lucas Balinhas Farias Anatomia do sistema reprodutivo feminino Genitália externa, vagina, cérvix, útero, ovidutos e ovários Maturidade Sexual É representada

Leia mais

1 Introdução à Endocrinologia. Os Hormônios Hipofisários.

1 Introdução à Endocrinologia. Os Hormônios Hipofisários. IX Endocrinologia e Reprodução 1 Introdução à Endocrinologia. Os Hormônios Hipofisários. As funções corporais são reguladas por dois sistemas principais: o sistema nervoso e o sistema hormonal ou endócrino.

Leia mais

BIOSSÍNTESE DOS HORMÔNIOS (Protéicos) Estoque citoplasmático - secreção

BIOSSÍNTESE DOS HORMÔNIOS (Protéicos) Estoque citoplasmático - secreção BIOSSÍNTESE DOS HORMÔNIOS (Protéicos) Estoque citoplasmático - secreção Exemplo HORMÔNIOS ESTEROIDES Sexuais e do tecido interrenal Outros tecidos Os esteroides estão envolvidos na regulação de vários

Leia mais

HIPÓFISE. - Neurohipófise (hipófise posterior)

HIPÓFISE. - Neurohipófise (hipófise posterior) 1. SISTEMA ENDÓCRINO Grande parte das funções e atividades do organismo é coordenada pelos sistemas nervoso e endócrino (hormonal). O sistema endócrino é composto por diversas glândulas (hipófise, tireoide,

Leia mais

Excreção. Manutenção do equilíbrio de sal, água e remoção de excretas nitrogenadas.

Excreção. Manutenção do equilíbrio de sal, água e remoção de excretas nitrogenadas. Fisiologia Animal Excreção Manutenção do equilíbrio de sal, água e remoção de excretas nitrogenadas. Sistema urinario Reabsorção de açucar, Glicose, sais, água. Regula volume sangue ADH: produzido pela

Leia mais

COMPONENTES ORGÂNICOS: CARBOIDRATOS. Glicídios ou Açúcares

COMPONENTES ORGÂNICOS: CARBOIDRATOS. Glicídios ou Açúcares COMPONENTES ORGÂNICOS: CARBOIDRATOS Glicídios ou Açúcares COMPOSIÇÃO DOS CARBOIDRATOS Compostos constituídos principalmente de: Carbono, Hidrogênio Oxigênio Principal fonte de energia para os seres vivos.

Leia mais

DISCIPLINA: Ciências da natureza SÉRIE: 2º. ALUNO(a):

DISCIPLINA: Ciências da natureza SÉRIE: 2º. ALUNO(a): GOIÂNIA, / / 2017 No Anhanguera você é + PROFESSOR: Mário Neto DISCIPLINA: Ciências da natureza SÉRIE: 2º ALUNO(a): Enem Antes de iniciar a lista de exercícios leia atentamente as seguintes orientações:

Leia mais

Aminoácidos (aas) Prof.ª: Suziane Antes Jacobs

Aminoácidos (aas) Prof.ª: Suziane Antes Jacobs Aminoácidos (aas) Prof.ª: Suziane Antes Jacobs Introdução Pequenas moléculas propriedades únicas Unidades estruturais (UB) das proteínas N- essencial para a manutenção da vida; 20 aminoácidos-padrão -

Leia mais

SISTEMA DIGESTIVO HUMANO (Parte 4)

SISTEMA DIGESTIVO HUMANO (Parte 4) SISTEMA DIGESTIVO HUMANO (Parte 4) INTESTINO DELGADO O intestino delgado de um adulto é um tubo com pouco mais de 6 m de comprimento por 4 cm de diâmetro, e é dividido em três regiões: duodeno (região

Leia mais

Sistema Endócrino. Objetivo da Aula. Anatomia I. Aula 10 p. 76

Sistema Endócrino. Objetivo da Aula. Anatomia I. Aula 10 p. 76 Sistema Endócrino Objetivo da Aula Compreender a divisão, forma e função do sistema endócrino. Adquirir a capacidade de aplicar este conhecimento na prática acadêmica e profissional da Educação Física.

Leia mais

Sinalização celular: Como as células se comunicam. Profa. Dra. Livia M. A. Tenuta

Sinalização celular: Como as células se comunicam. Profa. Dra. Livia M. A. Tenuta Sinalização celular: Como as células se comunicam Profa. Dra. Livia M. A. Tenuta Foto corpo humano Sinais fisiológicos: elétricos químicos 75 trilhões de células Tópicos a serem abordados Meios de comunicação

Leia mais

Pâncreas endócrino. Regulação do metabolismo orgânico e do balanço energético

Pâncreas endócrino. Regulação do metabolismo orgânico e do balanço energético Pâncreas endócrino Regulação do metabolismo orgânico e do balanço energético Esquema global do metabolismo energético Anabolismo x catabolismo Fluxo das vias energéticas * * * Via global da produção

Leia mais

METABOLISMO DE CARBOIDRATOS METABOLISMO DOS LIPÍDIOS METABOLISMO DE PROTEÍNAS

METABOLISMO DE CARBOIDRATOS METABOLISMO DOS LIPÍDIOS METABOLISMO DE PROTEÍNAS METABOLISMO DE CARBOIDRATOS METABOLISMO DOS LIPÍDIOS METABOLISMO DE PROTEÍNAS METABOLISMO DE CARBOIDRATOS GLICÓLISE Transporte da Glicose para dentro das Células: Glicose não difunde diretamente para

Leia mais

8. Quando ocorre a produção de calcitonina e paratormônio no organismo? Qual (is) glândula(s) o(s) produz(em)?

8. Quando ocorre a produção de calcitonina e paratormônio no organismo? Qual (is) glândula(s) o(s) produz(em)? CIÊNCIAS FÍSICAS E BIOLÓGICAS FUNDAMENTAL NII Listas 13 Sistema Endócrino 8º anos 3º período - 2012 1. Observe a imagem: a) Nomeie as glândulas indicadas pelas setas b) Relacione os seus hormônios 2. Diferencie

Leia mais

Metabolismo e produção de calor

Metabolismo e produção de calor Fisiologia 5 Metabolismo e produção de calor Iniciando a conversa Apenas comer não é suficiente: o alimento precisa ser transformado (metabolizado) para ser aproveitado por nosso organismo. Açúcares (carboidratos),

Leia mais

Absorção de luz pelas clorofilas. Fotofosforilação: ADP + Pi

Absorção de luz pelas clorofilas. Fotofosforilação: ADP + Pi Tabela de Biologia - Biologia Molecular Fotossíntese e fluxo de energia e formação de ATP Fotossíntese Equação geral: 12H 2 O + 6CO 2 C 6 H 12 O 6 + 6H 2 O + 6O 2 Fotoquímica ou luminosa Absorção de luz

Leia mais

Fisiologia Endócrina

Fisiologia Endócrina Fisiologia Endócrina Profa. Letícia Lotufo Claude Bernard: pai da endocrinologia Definiu o termo milieu intérieur Endocrinologia estudo das secreções internas do organismos. 1 Sistema Endócrino e Homeostasia

Leia mais

Embriologia e Histologia Animal II

Embriologia e Histologia Animal II Embriologia e Histologia Animal II HISTOFISIOLOGIA DO SISTEMA ENDÓCRINO Daniela dos Santos Brum Glândulas endócrinas Secretam seus produtos (moléculas biologicamente ativas) HORMÔNIOS Corrente sanguínea

Leia mais

FISIOLOGIA HUMANA SISTEMA ENDÓCRINO

FISIOLOGIA HUMANA SISTEMA ENDÓCRINO FISIOLOGIA HUMANA 1 SISTEMA ENDÓCRINO 2 1 Visão geral Sistema endócrino: Grupo de glândulas responsáveis por regular vários órgãos dentro do corpo; Satisfazer as necessidades de crescimento e reprodução

Leia mais

Universidade Federal dos Vales do Jequitinhonha e Mucuri - UFVJM. Fisiologia Endócrina. Introdução ao Sistema Endócrino

Universidade Federal dos Vales do Jequitinhonha e Mucuri - UFVJM. Fisiologia Endócrina. Introdução ao Sistema Endócrino Universidade Federal dos Vales do Jequitinhonha e Mucuri - UFVJM Fisiologia Endócrina Introdução ao Sistema Endócrino Prof. Wagner de Fátima Pereira Departamento de Ciências Básicas Faculdade de Ciências

Leia mais

30/05/2017. Metabolismo: soma de todas as transformações químicas que ocorrem em uma célula ou organismo por meio de reações catalisadas por enzimas

30/05/2017. Metabolismo: soma de todas as transformações químicas que ocorrem em uma célula ou organismo por meio de reações catalisadas por enzimas Metabolismo: soma de todas as transformações químicas que ocorrem em uma célula ou organismo por meio de reações catalisadas por enzimas Metabolismo energético: vias metabólicas de fornecimento de energia

Leia mais

Hipófise SISTEMA ENDÓCRINO. Glândulas endócrinas. Hipófise (pituitária) Tireóide Paratireóide Adrenal Pâncreas (glândula mista) Pineal Raduan

Hipófise SISTEMA ENDÓCRINO. Glândulas endócrinas. Hipófise (pituitária) Tireóide Paratireóide Adrenal Pâncreas (glândula mista) Pineal Raduan SISTEMA ENDÓCRINO Glândulas endócrinas Hipófise (pituitária) Tireóide Paratireóide Adrenal Pâncreas (glândula mista) Pineal Hipófise Neurohipófise (pituitária posterior) pars nervosa + infundíbulo ligação

Leia mais

Fisiologia: Digestão, Respiração, Circulação, Excreção, Coordenação e Reprodução

Fisiologia: Digestão, Respiração, Circulação, Excreção, Coordenação e Reprodução Fisiologia: Digestão, Respiração, Circulação, Excreção, Coordenação e Reprodução Fisiologia: Digestão, Respiração, Circulação, Excreção, Coordenação e Reprodução 1. A figura representa os sistemas digestivos

Leia mais

Exercício /1 - PARA APLICAR

Exercício /1 - PARA APLICAR CAMPUS FORTALEZA - CURSO DE EDUCAÇÃO FÍSICA ANATOMIA DOS SISTEMAS - 2018/1 Exercício 737-2018/1 - PARA APLICAR Página 1 ANÁLISE EXERCÍCIO-ED 737-2018/1ANATOMIA DOS SISTEMAS - Página 2 O Sistema Endócrino

Leia mais

Prof. Dra. Bruna Oneda

Prof. Dra. Bruna Oneda Hipertrofia Muscular Prof. Dra. Bruna Oneda Hipertrofia muscular A hipertrofia de fibras musculares individuais, com o treinamento de força, é resultante de um aumento da síntese de proteínas musculares,

Leia mais

Glândulas e hormonas

Glândulas e hormonas Glândulas e hormonas Fibra nervosa Capilar sanguíneo Hormona O corpo humano apresenta dois sistemas de comunicação interna: o sistema nervoso e o sistema hormonal ou endócrino. O sistema nervoso transmite

Leia mais

BIOLOGIA - 2 o ANO MÓDULO 11 SISTEMA ENDÓCRINO

BIOLOGIA - 2 o ANO MÓDULO 11 SISTEMA ENDÓCRINO BIOLOGIA - 2 o ANO MÓDULO 11 SISTEMA ENDÓCRINO Como pode cair no enem Os mecanismos de autorregulação que levam à homeostase, para garantir um equilíbrio dinâmico, implicam retroalimentação (feedback),

Leia mais

DICAS DO TIO MARCÃO FISIOLOGIA I Aluno(a) :... Série/Ano: 3º ANO Turma:... Data:.../.../ 2012 Professor(a): Msc. Marcos Morris TECIDO NERVOSO

DICAS DO TIO MARCÃO FISIOLOGIA I Aluno(a) :... Série/Ano: 3º ANO Turma:... Data:.../.../ 2012 Professor(a): Msc. Marcos Morris TECIDO NERVOSO 1 DICAS DO TIO MARCÃO FISIOLOGIA I Aluno(a) :... Série/Ano: 3º ANO Turma:... Data:.../.../ 2012 Professor(a): Msc. Marcos Morris 1. NEURÔNIO TECIDO NERVOSO Célula de origem ectodérmica, presente no sistema

Leia mais