Bases Moleculares da Obesidade e Diabetes. Hormônios e Diabetes

Tamanho: px
Começar a partir da página:

Download "Bases Moleculares da Obesidade e Diabetes. Hormônios e Diabetes"

Transcrição

1 Bases Moleculares da Obesidade e Diabetes Hormônios e Diabetes Prof. Carlos Castilho de Barros

2 SISTEMA ENDÓCRINO CONSISTE EM 1) Glândulas e células específicas, 2) Mensageiros químicos chamados Hormônios 3) Um órgão-alvo ou receptor.

3 As glândulas são classificadas em: Exócrina Endócrinas:

4 Hormônios (hormon = urgência) São moléculas sinalizadoras que regulam e coordenam várias funções biológicas no organismo. São substâncias químicas secretadas por uma célula ou grupo de células no sangue ou fluído extra celular, e que vão agir em um ou mais alvos, que podem estar próximos ou distantes, e onde exercem seus efeitos em baixíssimas concentrações

5 Quanto ao local de ação a atividade dos hormônios é classificada como: 1- Endócrina : alcança alvos distantes através da corrente sanguínea 2- Parácrina: atua em células ou tecidos vizinhos 3- Autócrina: age no próprio tecido ou células onde foi produzido.

6 SISTEMA NERVOSO SISTEMA ENDÓCRINO FUNÇÕES CORPORAIS

7 Hormônios produzidos em tecidos Periféricos Aparelho digestivo - estômago: gastrina grelina duodeno: Colicistocinina (CCK) Gastric inhibitory polypeptide (GIP) secretina motilina VIP íleo: enteroglucagon, Glucagon-like peptide-1 (GLP-1) fígado/outros: IGF (IGF-1, IGF-2) Tecido adiposo: leptina adiponectina resistina visfatina Ossos: osteocalcina Rim: JGA (renina) células peritubulares (eritropoietina - EPO) calcitriol prostaglandina Coração: peptídeo natriurético (atrial-anp cerebral- BNP) Músculo esquelético: irisina

8 S. NERVOSO S. Endócrino AGE RAPIDAMENTE AGE MAIS LENTAMENTE EFEITOS LOCALIZADOS E DE CURTA DURAÇÃO EFEITOS GERAIS E DE LONGA DURAÇÃO

9 HORMÔNIOS Os processos corporais geralmente estão sob controle hormonal " Controlam velocidade das reações enzimáticas " Controlam a expressão gênica e síntese de proteínas " Controlam o transporte das membranas plasmáticas através de segundos mensageiros " Induzem a atividade secretória

10 HORMÔNIOS Químicamente podem ser divididos em três classes (vertebrados): Hormônios peptídicos e proteicos: ex.: Peptídeos: TRH e vasopressina; Proteínas: insulina e hormônio do crescimento; Glicoproteínas: Hormônio luteinizante, hormônio folículoestimulante e hormônio estimulante da tireóide. Hormônios derivados de lípidos e fosfolípidos: principais são os hormônios esteróides que derivam de colesterol e os eicosanóides. Ex.: esteroides: testosterona e cortisol; Eicosanoides: prostaglandinas. Monoaminas derivados de aminoácidos aromáticos como fenilalanina, tirosina, triptofano; Ex.: adrenalina, noradrenalina; dopamina, serotonina, T3 e T4.

11 Derivados da tirosina Adrenalina Dopamina Noradrenalina Tiroxina (t4) Triiodotironina (t3) Derivados do triptofano Melatonina Serotonona

12 Esteróides Aldosterona Cortisol Estradiol Progesterona Testosterona Vitamina D

13 Peptideos Angiotensina Bradicinina Hormonio melanócito-estimulante Ocitocina Somatostatina Hormonio liberador de tireotrofina Vasopressina

14 Proteínas Adrenocorticotrofina (ACTH) Polipeptídeo pancreático Hormônio foliculo-estimulante (FSH) Hormônio liberador de gonadotrofinas (GnRH) Glucagon Fatores de crescimento semelhantes a insulina (IGFI, IGFII) Insulina Hormonio luteinizante (LH) Prolactina Hormônio paratireoideo (PTH) Hormônio do crescimento (GH) Somatotiberina (GHRH) Tireotrofina (TSH)

15

16

17 Célula Delta Célula Alfa α glucagon β insulina δ somatostatina Capilares Célula Beta PP polipeptídeo pancreático

18 Células β

19

20

21

22

23

24

25

26

27

28

29 Insulina e Sinalização

30

31 Seqüência do Receptor de Insulina Humano MGTGGRRGAAAAPLLVAVAALLLGAAGHLYPGEVCPGMDIRNNLTRLHELENCSVIEGHLQILLMFKTRPEDFR DLSFPKLIMITDYLLLFRVYGLESLKDLFPNLTVIRGSRLFFNYALVIFEMVHLKELGLYNLMNITRGSVRIEKNNEL CYLATIDWSRILDSVEDNYIVLNKDDNEECGDICPGTAKGKTNCPATVINGQFVERCWTHSHCQKVCPTICKSHG CTAEGLCCHSECLGNCSQPDDPTKCVACRNFYLDGRCVETCPPPYYHFQDWRCVNFSFCQDLHHKCKNSRR QGCHQYVIHNNKCIPECPSGYTMNSSNLLCTPCLGPCPKVCHLLEGEKTIDSVTSAQELRGCTVINGSLIINIRGG NNLAAELEANLGLIEEISGYLKIRRSALVSLSFFRKLRLIRGETLEIGNYSFYALDNQNLRQLWDWSKHNLTTTQG KLFFHYNPKLCLSEIHKMEEVSGTKGRQERNDIALKTNGDKASCENELLKFSYIRTSFDKILLRWEPYWPPDFRD LLGFMLFYKEAPYQNVTEFDGQDACGSNSWTVVDIDPPLRSNDPKSQNHPGWLMRGLKPWTQYAIFVKTLVTF SDERRTYGAKSDIIYVQTDATNPSVPLDPISVSNSSSQIILKWKPPSDPNGNITHYLVFWERQAEDSELFELDYCL KGLKLPSRTWSPPFESEDSQKHNQSEYEDSAGECCSCPKTDSQILKELEESSFRKTFEDYLHNVVFVPRKTSS GTGAEDPRPSRKRRSLGDVGNVTVAVPTVAAFPNTSSTSVPTSPEEHRPFEKVVNKESLVISGLRHFTGYRIEL QACNQDTPEERCSVAAYVSARTMPEAKADDIVGPVTHEIFENNVVHLMWQEPKEPNGLIVLYEVSYRRYGDEE LHLCVSRKHFALERGCRLRGLSPGNYSVRIRATSLAGNGSWTEPTYFYVTDYLDVPSNIAKIIIGPLIFVFLFSVVI GSIYLFLRKRQPDGPLGPLYASSNPEYLSASDVFPCSVYVPDEWEVSREKITLLRELGQGSFGMVYEGNAR DIIKGEAETRVAVKTVNESASLRERIEFLNEASVMKGFTCHHVVRLLGVVSKGQPTLVVMELMAHGDLKSYLRSL RPEAENNPGRPPPTLQEMIQMAAEIADGMAYLNAKKFVHRDLAARNCMVAHDFTVKIGDFGMTRDIYETDYYR KGGKGLLPVRWMAPESLKDGVFTTSSDMWSFGVVLWEITSLAEQPYQGLSNEQVLKFVMDGGYLDQPDNCPE RVTDLMRMCWQFNPKMRPTFLEIVNLLKDDLHPSFPEVSFFHSEENKAPESEELEMEFEDMENVPLDRSSHCQ REEAGGRDGGSSLGFKRSYEEHIPYTHMNGGKKNGRILTLPRSNPS

32 Transcrição Atividade tirosinaquinase Subunidade α Subunidade β Glicogênio Fosforilação

33 Glicose

34

35 Insulina e Metabolismo

36

37

38

39 Ácidos graxos

40 Glicogênio sintase Glicogênio fosforilase Glicoquinase Glicose6 fosfatase Frutose1,6-bisfosfatase Fosfofruto -quinase Fosfoenolpiruvatocarboxi-quinase Piruvato quinase Acetil-CoA carboxilase

41

42 DIABETES Mellitus Insulino-dependente (IDDM) Tipo I Não insulino-dependente (NIDDM) Tipo II -Normalmente acomete pessoas < 20 anos -Peso Normal -Produção de anticorpos contra as ilhotas - Inicia-se com uma insulite - Presença de atrofia e destruição das células beta -Normalmente acomete pessoas >30 anos -Obesos -Não apresentam insulite -Pequena diminuição das células beta - Diminuição dos receptores de insulina e de sua sinalização

Disciplina: Bioquímica Curso: Análises Clínicas 3º. Módulo Docente: Profa. Dra. Marilanda Ferreira Bellini

Disciplina: Bioquímica Curso: Análises Clínicas 3º. Módulo Docente: Profa. Dra. Marilanda Ferreira Bellini Disciplina: Bioquímica Curso: Análises Clínicas 3º. Módulo Docente: Profa. Dra. Marilanda Ferreira Bellini Do grego: Hormon = estimular Hormônios são substâncias químicas produzidas por um grupo de células

Leia mais

SISTEMA ENDÓCRINO Órgãos endócrinos e suas secreções, alvos e efeitos principais

SISTEMA ENDÓCRINO Órgãos endócrinos e suas secreções, alvos e efeitos principais LOCALIZAÇÃO SISTEMA ENDÓCRINO Órgãos endócrinos e suas secreções, alvos e efeitos principais TIPO QUÍMICO HORMÔNIO ALVO EFEITOS PRINCIPAIS Glândula pineal Glândula Amina Melatonina Desconhecido Controla

Leia mais

Fisiologia do Sistema Endócrino. Introdução e Conceitos Gerais. Profa. Dra. Rosângela F. Garcia

Fisiologia do Sistema Endócrino. Introdução e Conceitos Gerais. Profa. Dra. Rosângela F. Garcia Fisiologia do Sistema Endócrino Introdução e Conceitos Gerais Profa. Dra. Rosângela F. Garcia SISTEMA ENDÓCRINO 1- INTRODUÇÃO SISTEMA DE CONTROLE HOMEOSTASE MENSAGEIROS HORMÔNIOS *não formam um sistema

Leia mais

Pâncreas Endócrino. Prof. Dr. Luiz Carlos C. Navegantes. Ramal: 4635

Pâncreas Endócrino. Prof. Dr. Luiz Carlos C. Navegantes. Ramal: 4635 Pâncreas Endócrino Prof. Dr. Luiz Carlos C. Navegantes navegantes@fmrp.usp.br Ramal: 4635 O diabetes mellitus É uma síndrome decorrente da falta de insulina ou da incapacidade de a insulina de exercer

Leia mais

AULA 02 - Eixo Hipotálamo-Hipofisário DOTS - JOGO DOS PONTOS

AULA 02 - Eixo Hipotálamo-Hipofisário DOTS - JOGO DOS PONTOS AULA 02 - Eixo Hipotálamo-Hipofisário DOTS - JOGO DOS PONTOS 1. A neuro-hipófise armazena e libera dois hormônios. Quais são estes? a) Hormônio antidiurético (ADH) e folículo estimulante (FSH) b) Prolactina

Leia mais

Fisiologia do Sistema Endócrino. Pâncreas Endócrino. Anatomia Microscópica. Anatomia Microscópica

Fisiologia do Sistema Endócrino. Pâncreas Endócrino. Anatomia Microscópica. Anatomia Microscópica Fisiologia do Sistema Endócrino Pâncreas Endócrino Prof. Dr. Leonardo Rigoldi Bonjardim Profa. Adjunto do Depto. De Fisiologia-CCBS-UFS Material disponível em: http://www.fisiologiaufs.xpg.com.br 2006

Leia mais

Glândulas endócrinas:

Glândulas endócrinas: SISTEMA ENDÓCRINO Glândulas endócrinas: Funções: Secreções de substâncias (hormônios) que atuam sobre célula alvo Regulação do organismo (homeostase) Hormônios: Substâncias químicas que são produzidas

Leia mais

GLÂNDULAS DEFINIÇÃO TIPOS DE SECREÇÕES. São um conjunto de células especializadas que têm como finalidade produzir secreções.

GLÂNDULAS DEFINIÇÃO TIPOS DE SECREÇÕES. São um conjunto de células especializadas que têm como finalidade produzir secreções. DEFINIÇÃO São um conjunto de células especializadas que têm como finalidade produzir secreções. TIPOS DE SECREÇÕES Hormônios substâncias químicas que vão atuar em locais distantes da sua fabricação, tendo

Leia mais

Mecanismo de Ação Hormonal

Mecanismo de Ação Hormonal Centro de Ciências da Vida Faculdade de Ciências Biológicas Mecanismo de Ação Hormonal Prof. Dr. Alexandre Rezende Endocrinologia Comunicação dentro do nosso corpo: (1) Sistema nervoso (2) Sistema endócrino

Leia mais

Sistema Endócrino. Importância da endocrinologia... Introdução 17/6/2009 ROTEIRO DA AULA. Glândulas Endócrinas

Sistema Endócrino. Importância da endocrinologia... Introdução 17/6/2009 ROTEIRO DA AULA. Glândulas Endócrinas UNESP -FCAV -JABOTICABAL AGRONOMIA FISIOLOGIA DOS ANIMAIS DOMÉTICOS II Sistema Endócrino ROTEIRO DA AULA Introdução a endocrinologia Hormônios -definições, mecanismos de sinalização, química e mecanismo

Leia mais

Componentes do Sistema Endócrino

Componentes do Sistema Endócrino Fisiologia 7 O sistema endócrino Iniciando a conversa Quem nunca sentiu os efeitos dos hormônios? Nesta aula, vamos conhecer um pouco mais sobre essas intrigantes moléculas, sua fabricação e seus efeitos.

Leia mais

Glândulas endócrinas:

Glândulas endócrinas: Sistema Endócrino Glândulas endócrinas: Funções: Secreções de substâncias (hormônios) que atuam sobre célula alvo Hormônios: Substâncias informacionais distribuídas pelo sangue. Eles modificam o funcionamento

Leia mais

Fisiologia celular I. Fisiologia Prof. Msc Brunno Macedo

Fisiologia celular I. Fisiologia Prof. Msc Brunno Macedo celular I celular I Objetivo Conhecer os aspectos relacionados a manutenção da homeostasia e sinalização celular Conteúdo Ambiente interno da célula Os meios de comunicação e sinalização As bases moleculares

Leia mais

SISTEMA ENDÓCRINO - 1 Figuras desta aula são do livro de Silverthorn

SISTEMA ENDÓCRINO - 1 Figuras desta aula são do livro de Silverthorn SISTEMA ENDÓCRINO - 1 Figuras desta aula são do livro de Silverthorn Bernardo Baldisserotto Departamento de Fisiologia e Farmacologia Universidade Federal de Santa Maria, Brasil Sistema nervoso: usualmente

Leia mais

Pâncreas Endócrino Controle da glicemia

Pâncreas Endócrino Controle da glicemia Pâncreas Endócrino Controle da glicemia Curso de Odontologia da UEM Prof. Kellen Brunaldi Silverthorn (Cap. 22) Guyton (Cap. 78) O SNC é responsável por cerca de 50% da glicose diariamente consumida para

Leia mais

Sistema Endócrino. O que é um SISTEMA? SISTEMA 5/6/2010. Prof. Mst. Sandro de Souza CÉLULAS TECIDOS ÓRGÃOS. Disciplina: FISIOLOGIA HUMANA

Sistema Endócrino. O que é um SISTEMA? SISTEMA 5/6/2010. Prof. Mst. Sandro de Souza CÉLULAS TECIDOS ÓRGÃOS. Disciplina: FISIOLOGIA HUMANA Disciplina: FISIOLOGIA HUMANA Sistema Endócrino Prof. Mst. Sandro de Souza O que é um SISTEMA? CÉLULAS TECIDOS ÓRGÃOS SISTEMA É um grupo de Órgãos 1 Sistema Endócrino É composto de um grupo diverso de

Leia mais

GUIA DE ESTUDOS INSULINA E GLUCAGON

GUIA DE ESTUDOS INSULINA E GLUCAGON GUIA DE ESTUDOS INSULINA E GLUCAGON 1) O pâncreas é uma glândula mista, ou seja, possui função endócrina e exócrina. Na porção endócrina, o pâncreas produz dois hormônios: a insulina e o Esses hormônios

Leia mais

GUIA DE ESTUDOS INSULINA E GLUCAGON

GUIA DE ESTUDOS INSULINA E GLUCAGON GUIA DE ESTUDOS INSULINA E GLUCAGON 1) O pâncreas é uma glândula mista, ou seja, possui função endócrina e exócrina. Na porção endócrina, o pâncreas produz dois hormônios: a insulina e o Esses hormônios

Leia mais

4/19/2007 Fisiologia Animal - Arlindo Moura 1

4/19/2007 Fisiologia Animal - Arlindo Moura 1 4/19/2007 Fisiologia Animal - Arlindo Moura 1 HIPOTALAMO Neuronios do hipotalamo sintetizam TRH (hormonio tireotrofico) Sistema portahipotalamico hipofisario TRH estimula a sintese e secreacao de TSH (hormonio

Leia mais

PERÍODO ABSORTIVO E PÓS-ABSORTIVO

PERÍODO ABSORTIVO E PÓS-ABSORTIVO PERÍODO ABSORTIVO E PÓS-ABSORTIVO HORMONAS QUE REGULAM O METABOLISMO PRINCIPAIS FONTES DE ENERGIA CELULAR VIAS METABÓLICAS DO PERIODO ABSORTIVO ALTERAÇÕES METABÓLICAS DO PERIODO PÓS-ABSORTIVO PRODUÇÃO

Leia mais

Sistema endócrino é formado pelo conjunto de glândulas que apresentam como atividade característica a produção e secreções de hormônios.

Sistema endócrino é formado pelo conjunto de glândulas que apresentam como atividade característica a produção e secreções de hormônios. alexandre.personal@hotmail.com www.professoralexandrerocha.com.br Sistema endócrino é formado pelo conjunto de glândulas que apresentam como atividade característica a produção e secreções de hormônios.

Leia mais

Aula: Sistemas Reguladores II. Sistema Endócrino

Aula: Sistemas Reguladores II. Sistema Endócrino Aula: Sistemas Reguladores II Sistema Endócrino PROFESSOR: Brenda Braga DATA:29/05/2014 Sistema Endócrino Formado pelo conjunto de Glândulas Endócrinas Responsáveis pela secreção de hormônios. Apenas algumas

Leia mais

Regulação Hormonal. Sistema endócrino é o conjunto formado por glândulas endócrinas e exócrinas

Regulação Hormonal. Sistema endócrino é o conjunto formado por glândulas endócrinas e exócrinas Regulação Hormonal Sistema endócrino é o conjunto formado por glândulas endócrinas e exócrinas que apresentam como actividade característica a produção de secreções denominadas hormonas, que são lançados

Leia mais

Importância dos processos de sinalização. Moléculas sinalizadoras (proteínas, peptídeos, aminoácidos, hormônios, gases)

Importância dos processos de sinalização. Moléculas sinalizadoras (proteínas, peptídeos, aminoácidos, hormônios, gases) Sinalização celular Importância dos processos de sinalização Seres unicelulares Seres multicelulares Moléculas sinalizadoras (proteínas, peptídeos, aminoácidos, hormônios, gases) Receptores Proteínas -

Leia mais

SISTEMA HIPOTÁLAMO- HIPOFISÁRIO

SISTEMA HIPOTÁLAMO- HIPOFISÁRIO SISTEMA HIPOTÁLAMO- HIPOFISÁRIO Localização Importância -controle de secreção de vários hormônios -controle de vários processos fisiológicos: reprodução desenvolvimento e crescimento metabolismo energético

Leia mais

Universidade Federal dos Vales do Jequitinhonha e Mucuri - UFVJM. Fisiologia Endócrina. O Pâncreas. Prof. Wagner de Fátima Pereira

Universidade Federal dos Vales do Jequitinhonha e Mucuri - UFVJM. Fisiologia Endócrina. O Pâncreas. Prof. Wagner de Fátima Pereira Universidade Federal dos Vales do Jequitinhonha e Mucuri - UFVJM Fisiologia Endócrina O Pâncreas Prof. Wagner de Fátima Pereira Departamento de Ciências Básicas Faculdade de Ciências Biológica e da Saúde

Leia mais

Cada célula é programada para responder a combinações específicas de moléculas sinalizadoras

Cada célula é programada para responder a combinações específicas de moléculas sinalizadoras Sinalização celular Cada célula é programada para responder a combinações específicas de moléculas sinalizadoras Etapas da Sinalização 1) Síntese e liberação da molécula sinalizadora pela célula sinalizadora

Leia mais

SISTEMA ENDÓCRINO. Hipotálamo Paratireóide

SISTEMA ENDÓCRINO. Hipotálamo Paratireóide INTRODUÇÃO O sistema endócrino é composto por um grupo de tecidos especializados chamados glândulas cuja função é produzir e liberar na corrente sanguínea substâncias chamadas s. Os hormônios são transportados

Leia mais

SISTEMA ENDÓCRINO órgãos hormônios

SISTEMA ENDÓCRINO órgãos hormônios SISTEMA ENDÓCRINO Conjunto de órgãos que apresentam como atividade característica a produção de secreções denominadas hormônios, que são lançados na corrente sanguínea e irão atuar em outra parte do organismo,

Leia mais

Sistema Endócrino. Objetivo da Aula. Anatomia I. Aula 10 p. 76

Sistema Endócrino. Objetivo da Aula. Anatomia I. Aula 10 p. 76 Sistema Endócrino Objetivo da Aula Compreender a divisão, forma e função do sistema endócrino. Adquirir a capacidade de aplicar este conhecimento na prática acadêmica e profissional da Educação Física.

Leia mais

Sistema endócrino. Epitélio glandular. Funcionalmente:

Sistema endócrino. Epitélio glandular. Funcionalmente: Sistema endócrino Epitélio glandular Endócrina: secreção de hormônios diretamente no sangue Exócrina: secreção de seus produtos em ductos Funcionalmente: Merócrinas Apócrinas Holócrinas Unicelulares (Células

Leia mais

REGULAÇÃO HORMONAL DO METABOLISMO PROTEÍCO

REGULAÇÃO HORMONAL DO METABOLISMO PROTEÍCO REGULAÇÃO HORMONAL DO METABOLISMO PROTEÍCO Giovanni Resende de Oliveira giovanni@epamig.br Fonte: ROCHA,C e OLIVEIRA, R.S INTRODUÇÃO Crescimento do Animal Crescimento dos Tecidos Grau de hiperplasia e

Leia mais

Epinefrina, glucagon e insulina. Hormônios com papéis fundamentais na regulação do metabolismo

Epinefrina, glucagon e insulina. Hormônios com papéis fundamentais na regulação do metabolismo Epinefrina, glucagon e insulina Hormônios com papéis fundamentais na regulação do metabolismo Epinefrina ou adrenalina Estímulos para a secreção de epinefrina: Perigos reais ou imaginários Exercício físico

Leia mais

Sinalização celular: Como as células se comunicam. Profa. Dra. Livia M. A. Tenuta

Sinalização celular: Como as células se comunicam. Profa. Dra. Livia M. A. Tenuta Sinalização celular: Como as células se comunicam Profa. Dra. Livia M. A. Tenuta Foto corpo humano Sinais fisiológicos: elétricos químicos 75 trilhões de células Tópicos a serem abordados Meios de comunicação

Leia mais

FISIOLOGIA HUMANA SISTEMA ENDÓCRINO

FISIOLOGIA HUMANA SISTEMA ENDÓCRINO FISIOLOGIA HUMANA 1 SISTEMA ENDÓCRINO 2 1 Visão geral Sistema endócrino: Grupo de glândulas responsáveis por regular vários órgãos dentro do corpo; Satisfazer as necessidades de crescimento e reprodução

Leia mais

SUMÁRIO Aula 9: Eixo hipotálamo-hipófise

SUMÁRIO Aula 9: Eixo hipotálamo-hipófise SUMÁRIO Aula 9: Eixo hipotálamo-hipófise 9.1 Introdução: o hipotálamo e a glândula hipófise 9.2 Hipófise posterior (neuro-hipófise) 9.3 Hipófise anterior (adeno-hipófise) 9.1 Introdução: o hipotálamo e

Leia mais

UNIVERSIDADE ESTADUAL DA BAHIA - UNEB DEPARTAMENTO DE CIÊNCIAS DA VIDA DCV CCS006 - BIOLOGIA CELULAR. Sinalização Celular SALVADOR - BA 2016

UNIVERSIDADE ESTADUAL DA BAHIA - UNEB DEPARTAMENTO DE CIÊNCIAS DA VIDA DCV CCS006 - BIOLOGIA CELULAR. Sinalização Celular SALVADOR - BA 2016 UNIVERSIDADE ESTADUAL DA BAHIA - UNEB DEPARTAMENTO DE CIÊNCIAS DA VIDA DCV CCS006 - BIOLOGIA CELULAR Sinalização Celular PROFª POLYANNA CARÔZO DE OLIVEIRA SALVADOR - BA 2016 Introdução Evolução da multicelularidade

Leia mais

Excreção. Manutenção do equilíbrio de sal, água e remoção de excretas nitrogenadas.

Excreção. Manutenção do equilíbrio de sal, água e remoção de excretas nitrogenadas. Fisiologia Animal Excreção Manutenção do equilíbrio de sal, água e remoção de excretas nitrogenadas. Sistema urinario Reabsorção de açucar, Glicose, sais, água. Regula volume sangue ADH: produzido pela

Leia mais

Universidade Federal dos Vales do Jequitinhonha e Mucuri - UFVJM. Fisiologia Endócrina. Introdução ao Sistema Endócrino

Universidade Federal dos Vales do Jequitinhonha e Mucuri - UFVJM. Fisiologia Endócrina. Introdução ao Sistema Endócrino Universidade Federal dos Vales do Jequitinhonha e Mucuri - UFVJM Fisiologia Endócrina Introdução ao Sistema Endócrino Prof. Wagner de Fátima Pereira Departamento de Ciências Básicas Faculdade de Ciências

Leia mais

COMPONENTES ORGÂNICOS: CARBOIDRATOS. Glicídios ou Açúcares

COMPONENTES ORGÂNICOS: CARBOIDRATOS. Glicídios ou Açúcares COMPONENTES ORGÂNICOS: CARBOIDRATOS Glicídios ou Açúcares COMPOSIÇÃO DOS CARBOIDRATOS Compostos constituídos principalmente de: Carbono, Hidrogênio Oxigênio Principal fonte de energia para os seres vivos.

Leia mais

Fisiologia Endócrina

Fisiologia Endócrina Fisiologia Endócrina Profa. Letícia Lotufo Claude Bernard: pai da endocrinologia Definiu o termo milieu intérieur Endocrinologia estudo das secreções internas do organismos. 1 Sistema Endócrino e Homeostasia

Leia mais

Embriologia e Histologia Animal II

Embriologia e Histologia Animal II Embriologia e Histologia Animal II HISTOFISIOLOGIA DO SISTEMA ENDÓCRINO Daniela dos Santos Brum Glândulas endócrinas Secretam seus produtos (moléculas biologicamente ativas) HORMÔNIOS Corrente sanguínea

Leia mais

30/05/2017. Metabolismo: soma de todas as transformações químicas que ocorrem em uma célula ou organismo por meio de reações catalisadas por enzimas

30/05/2017. Metabolismo: soma de todas as transformações químicas que ocorrem em uma célula ou organismo por meio de reações catalisadas por enzimas Metabolismo: soma de todas as transformações químicas que ocorrem em uma célula ou organismo por meio de reações catalisadas por enzimas Metabolismo energético: vias metabólicas de fornecimento de energia

Leia mais

8. Quando ocorre a produção de calcitonina e paratormônio no organismo? Qual (is) glândula(s) o(s) produz(em)?

8. Quando ocorre a produção de calcitonina e paratormônio no organismo? Qual (is) glândula(s) o(s) produz(em)? CIÊNCIAS FÍSICAS E BIOLÓGICAS FUNDAMENTAL NII Listas 13 Sistema Endócrino 8º anos 3º período - 2012 1. Observe a imagem: a) Nomeie as glândulas indicadas pelas setas b) Relacione os seus hormônios 2. Diferencie

Leia mais

DICAS DO TIO MARCÃO FISIOLOGIA I Aluno(a) :... Série/Ano: 3º ANO Turma:... Data:.../.../ 2012 Professor(a): Msc. Marcos Morris TECIDO NERVOSO

DICAS DO TIO MARCÃO FISIOLOGIA I Aluno(a) :... Série/Ano: 3º ANO Turma:... Data:.../.../ 2012 Professor(a): Msc. Marcos Morris TECIDO NERVOSO 1 DICAS DO TIO MARCÃO FISIOLOGIA I Aluno(a) :... Série/Ano: 3º ANO Turma:... Data:.../.../ 2012 Professor(a): Msc. Marcos Morris 1. NEURÔNIO TECIDO NERVOSO Célula de origem ectodérmica, presente no sistema

Leia mais

Metabolismo e produção de calor

Metabolismo e produção de calor Fisiologia 5 Metabolismo e produção de calor Iniciando a conversa Apenas comer não é suficiente: o alimento precisa ser transformado (metabolizado) para ser aproveitado por nosso organismo. Açúcares (carboidratos),

Leia mais

SISTEMA ENDÓCRINO SISTEMA HORMONAL

SISTEMA ENDÓCRINO SISTEMA HORMONAL SISTEMA ENDÓCRINO SISTEMA HORMONAL HORMÔNIOS 1. MENSAGEIROS QUÍMICOS PRODUZIDOS PELAS GLÂNDULAS ENDÓCRINAS. 2. REGULADORES: - (ESTIMULANTES OU INIBIDORES) - (CRESCIMENTO, METABOLISMO, REPRODUÇÃO, ETC.)

Leia mais

Absorção de luz pelas clorofilas. Fotofosforilação: ADP + Pi

Absorção de luz pelas clorofilas. Fotofosforilação: ADP + Pi Tabela de Biologia - Biologia Molecular Fotossíntese e fluxo de energia e formação de ATP Fotossíntese Equação geral: 12H 2 O + 6CO 2 C 6 H 12 O 6 + 6H 2 O + 6O 2 Fotoquímica ou luminosa Absorção de luz

Leia mais

Ação Hormonal no Metabolismo

Ação Hormonal no Metabolismo Ação Hormonal no Metabolismo O Metabolismo é composto por muitas reações interconectadas (reações catabólicas e anabólicas). Metabolismo de Carboidratos Complexos Metabolismo de Lipídios Complexos Metabolismo

Leia mais

PÂNCREAS ENDÓCRINO E A REGULAÇÃO DA GLICEMIA. Prof. Hélder Mauad

PÂNCREAS ENDÓCRINO E A REGULAÇÃO DA GLICEMIA. Prof. Hélder Mauad PÂNCREAS ENDÓCRINO E A REGULAÇÃO DA GLICEMIA Prof. Hélder Mauad PÂNCREAS SOMATOSTATINA ENDÓCRINO A somatostatina é classificada como um hormônio inibitório, cujas principais ações Além são: da

Leia mais

Sistema endócrino. Apostila 3 Página 22

Sistema endócrino. Apostila 3 Página 22 Sistema endócrino Apostila 3 Página 22 Sistema mensageiro Hormônios: informacionais, produzidas pelas glândulas endócrinas e distribuídas pelo sangue. Órgão-alvo: reage ao estímulo do hormônio. Sistema

Leia mais

10/09/2015. Glândula pineal. Hormônio Melatonina : produzido à noite, na ausência de luz. Crescimento; Regulação do sono; CONTROLE HORMONAL

10/09/2015. Glândula pineal. Hormônio Melatonina : produzido à noite, na ausência de luz. Crescimento; Regulação do sono; CONTROLE HORMONAL Glândulas endócrinas e tecidos que secretam hormônios; Coordena funções do organismo CONTROLE HORMONAL S. Nervoso + S. endócrino = Homeostase Mensageiros químicos; Atuam em um tecido ou órgão alvo específico;

Leia mais

SISTEMA ENDÓCRINO. Prof. TIAGO

SISTEMA ENDÓCRINO. Prof. TIAGO SISTEMA ENDÓCRINO Prof. TIAGO CARACTERÍSTICAS GERAIS INTEGRAÇÃO DOS SISTEMAS. CONTROLEDEATIVIDADES FISIOLOGICAS. SEMELHANTE AO SISTEMA NERVOSO. EFETUADO POR HORMÔNIOS TRANSPORTADO PELA CORRENTE SANGUINEA

Leia mais

INTRODUÇÃO AO ESTUDO FISIOLOGIA DI SISTEMA NERVOSO AUTONOMO. Fundamentos da organização morfo-funcional do SNA.

INTRODUÇÃO AO ESTUDO FISIOLOGIA DI SISTEMA NERVOSO AUTONOMO. Fundamentos da organização morfo-funcional do SNA. INTRODUÇÃO AO ESTUDO DA FISIOLOGIA DI SISTEMA NERVOSO AUTONOMO Fundamentos da organização morfo-funcional do SNA. Obs: O texto abaixo apresenta caráter introdutório, dessa forma, não substitui as aulas

Leia mais

Mensageiros Químicos. Introdução: As Comunicações entre as células: 3 Tipos de Moléculas: Receptores:

Mensageiros Químicos. Introdução: As Comunicações entre as células: 3 Tipos de Moléculas: Receptores: Introdução: A célula é uma entidade isolada em sua própria membrana, bem como as suas organelas que também se encontram envoltas em sua próprias membranas, separando-as do restante da célula. Desta forma

Leia mais

Prof. Dra. Bruna Oneda

Prof. Dra. Bruna Oneda Hipertrofia Muscular Prof. Dra. Bruna Oneda Hipertrofia muscular A hipertrofia de fibras musculares individuais, com o treinamento de força, é resultante de um aumento da síntese de proteínas musculares,

Leia mais

BIOLOGIA - 2 o ANO MÓDULO 11 SISTEMA ENDÓCRINO

BIOLOGIA - 2 o ANO MÓDULO 11 SISTEMA ENDÓCRINO BIOLOGIA - 2 o ANO MÓDULO 11 SISTEMA ENDÓCRINO Como pode cair no enem Os mecanismos de autorregulação que levam à homeostase, para garantir um equilíbrio dinâmico, implicam retroalimentação (feedback),

Leia mais

d) uma célula é alvo apenas para um dado hormônio e) uma determinada função pode ser controlada por vários hormônios

d) uma célula é alvo apenas para um dado hormônio e) uma determinada função pode ser controlada por vários hormônios Fisiologia Endócrina - Bloco 1 de exercícios 1. O mecanismo de feedback ou retroação é o principal meio regulador da secreção das glândulas endócrinas. Um exemplo de feedback negativo é: a) aumento da

Leia mais

Introdução à Bioquímica. Lipídeos. Dra. Fernanda Canduri Laboratório de Sistemas BioMoleculares. Departamento de Física.. UNESP. www.

Introdução à Bioquímica. Lipídeos. Dra. Fernanda Canduri Laboratório de Sistemas BioMoleculares. Departamento de Física.. UNESP. www. Introdução à Bioquímica Lipídeos Dra. Fernanda Canduri Laboratório de Sistemas BioMoleculares. Departamento de Física.. UNESP São José do Rio Preto - SP. Tópicos! Classificação dos lipídeos! Ácidos graxos!

Leia mais

Profª Leticia Pedroso

Profª Leticia Pedroso Profª Leticia Pedroso Sistema Endócrino O homem apresenta em seu organismo várias glândulas endócrinas (glândulas que secretam hormônios para dentro do sangue). Hormônios são mensageiros químicos responsáveis

Leia mais

Profº André Montillo www.montillo.com.br

Profº André Montillo www.montillo.com.br Profº André Montillo www.montillo.com.br Introdução: A célula é uma entidade isolada em sua própria membrana, bem como as suas organelas que também se encontram envoltas em sua próprias membranas, separando-as

Leia mais

Fisiologia: Digestão, Respiração, Circulação, Excreção, Coordenação e Reprodução

Fisiologia: Digestão, Respiração, Circulação, Excreção, Coordenação e Reprodução Fisiologia: Digestão, Respiração, Circulação, Excreção, Coordenação e Reprodução Fisiologia: Digestão, Respiração, Circulação, Excreção, Coordenação e Reprodução 1. A figura representa os sistemas digestivos

Leia mais

Bioquímica: Componentes orgânicos e inorgânicos necessários à vida. Leandro Pereira Canuto

Bioquímica: Componentes orgânicos e inorgânicos necessários à vida. Leandro Pereira Canuto Bioquímica: orgânicos e inorgânicos necessários à vida Leandro Pereira Canuto Toda matéria viva: C H O N P S inorgânicos orgânicos Água Sais Minerais inorgânicos orgânicos Carboidratos Proteínas Lipídios

Leia mais

SISTEMA ENDÓCRINO. Prof. Diego Ceolin

SISTEMA ENDÓCRINO. Prof. Diego Ceolin SISTEMA ENDÓCRINO Prof. Diego Ceolin INTRODUÇÃO Função: Atua juntamente com o sistema nervoso para o equilíbrio corporal ( Homeostase ) HOMEOSTASE Tendência permanente do organismo manter a constância

Leia mais

ZOOLOGIA E HISTOLOGIA ANIMAL

ZOOLOGIA E HISTOLOGIA ANIMAL ZOOLOGIA E HISTOLOGIA ANIMAL Sistema Endócrino Prof. Fernando Stuchi Introdução Os mensageiros químicos do corpo (hormônios) são produzidos pelas glândulas endócrinas ou glândulas de secreção interna,

Leia mais

Sistema endócrino I. As células produtoras de hormônios estão geralmente reunidas em órgãos denominados glândulas endócrinas.

Sistema endócrino I. As células produtoras de hormônios estão geralmente reunidas em órgãos denominados glândulas endócrinas. RESUMO DE AULA Sistema endócrino I O funcionamento e equilíbrio fisiológico do corpo humano dependem em parte da comunicação entre as células por meio de mensageiros químicos denominados de hormônios.

Leia mais

METABOLISMO ENERGÉTICO integração e regulação alimentado jejum catabólitos urinários. Bioquímica. Profa. Dra. Celene Fernandes Bernardes

METABOLISMO ENERGÉTICO integração e regulação alimentado jejum catabólitos urinários. Bioquímica. Profa. Dra. Celene Fernandes Bernardes METABOLISMO ENERGÉTICO integração e regulação alimentado jejum catabólitos urinários Bioquímica Profa. Dra. Celene Fernandes Bernardes REFERÊNCIA: Bioquímica Ilustrada - Champe ESTÁGIOS DO CATABOLISMO

Leia mais

Hormônios hipotalâmicos e hipofisários. (somatostatin)

Hormônios hipotalâmicos e hipofisários. (somatostatin) Anatomia Localiza-se na base do crânio sela túrcica Hipófise anterior: derivada da bolsa de Rathke Hipófise posterior: origem neural, formada por axônios e terminções nervosas dos neurônios hipotalâmicos

Leia mais

ANATOMIA DOS ANIMAIS DOMÉSTICOS Sistema Endócrino

ANATOMIA DOS ANIMAIS DOMÉSTICOS Sistema Endócrino ANATOMIA DOS ANIMAIS DOMÉSTICOS Sistema Endócrino O sistema nervoso e as glândulas endócrinas são os dois principais mecanismos de comunicação e coordenação do corpo humano. Eles regulam quase todos os

Leia mais

Anatomia e Fisiologia Animal Sistema Endócrino. Profa. Valdirene Zabot Unochapecó

Anatomia e Fisiologia Animal Sistema Endócrino. Profa. Valdirene Zabot Unochapecó Anatomia e Fisiologia Animal Sistema Endócrino Profa. Valdirene Zabot Unochapecó Sistema de Comunicação Corpórea: Endócrino Nervoso Produtos = Hormônios: ajudam a enviar informações para outras células

Leia mais

SISTEMA ENDÓCRINO. Prof. Me. Leandro Parussolo

SISTEMA ENDÓCRINO. Prof. Me. Leandro Parussolo SISTEMA ENDÓCRINO Prof. Me. Leandro Parussolo Sistema Endócrino Função de garantir o fluxo de informações entre diferentes cells, permitindo a integração funcional de todo o organismo; Garantir a reprodução;

Leia mais

Módulo II.III Fisiologia. Tratado de Fisiologia Média, GUYTON & HALL, 11º Edição. Pâncreas Endócrino

Módulo II.III Fisiologia. Tratado de Fisiologia Média, GUYTON & HALL, 11º Edição. Pâncreas Endócrino Módulo II.III Fisiologia Tema da Aula: Pâncreas Endócrino Docente: Dr. António Martins Baptista Data: 6/01/2009 Número da Aula Previsto: 20 Desgravador: Mariana Rodrigues Nunes Corrector: Ana Sofia Fontes

Leia mais

Lipídios. 1. Importância: 2. Lipídios de armazenamento: São as gorduras e óleos 25/11/2012. Aula 2 Estrutura de. Lipídios

Lipídios. 1. Importância: 2. Lipídios de armazenamento: São as gorduras e óleos 25/11/2012. Aula 2 Estrutura de. Lipídios Universidade Federal de Pelotas Disciplina de Bioquímica Lipídios Aula 2 Estrutura de Lipídios Os lipídios apesar de quimicamente diferentes entre si, exibem como característica definidora e comum a insolubilidade

Leia mais

Pâncreas O Pâncreas é um órgão do sistema digestivo e endócrino. Tem uma função exócrina (segregando suco pancreático que contém enzimas digestivas) e

Pâncreas O Pâncreas é um órgão do sistema digestivo e endócrino. Tem uma função exócrina (segregando suco pancreático que contém enzimas digestivas) e Projecto Tutorial - Diabetes Trabalho realizado por: Carlos Bernardo 2 º Ano Bioquímica No âmbito da Cadeira de M.E.T. III Ano Lectivo: 2007/2008 Pâncreas O Pâncreas é um órgão do sistema digestivo e endócrino.

Leia mais

MECANISMO DE AÇÃO DOS HORMÔNIOS *

MECANISMO DE AÇÃO DOS HORMÔNIOS * MECANISMO DE AÇÃO DOS HORMÔNIOS * Introdução A coordenação do metabolismo nos mamíferos é realizada pelo sistema neuroendócrino, a base do controle dos outros sistemas, estando, portanto, estreitamente

Leia mais

Pontifícia Universidade Católica de Goiás Departamento de Ciências Aeronáuticas. Sistema Endócrino. Prof. Raimundo Júnior M.Sc.

Pontifícia Universidade Católica de Goiás Departamento de Ciências Aeronáuticas. Sistema Endócrino. Prof. Raimundo Júnior M.Sc. Pontifícia Universidade Católica de Goiás Departamento de Ciências Aeronáuticas Sistema Endócrino Prof. Raimundo Júnior M.Sc. Sistema Hormonal atua como um sistema de controle e regulação (assim como o

Leia mais

INTESTINO DELGADO SECREÇÕES ENTÉRICAS E PANCREÁTICAS

INTESTINO DELGADO SECREÇÕES ENTÉRICAS E PANCREÁTICAS INTESTINO DELGADO SECREÇÕES ENTÉRICAS E PANCREÁTICAS PÂNCREAS Glândula mista PÂNCREAS PÂNCREAS ENDÓCRINA Glândula mista EXÓCRINA PÂNCREAS ENDÓCRINA (Ilhotas de Langerhans) Glândula mista EXÓCRINA PÂNCREAS

Leia mais

Fisiologia do Sistema Endócrino e o papel da Melatonina

Fisiologia do Sistema Endócrino e o papel da Melatonina Liga Acadêmica de Farmacologia Fisiologia do Sistema Endócrino e o papel da Melatonina Prof. Dr. Luiz Carlos dos Reis Melatonin, human aging, and age-related diseases M Karaseka Experimental Gerontology

Leia mais

Universidade Castelo Branco Bases Anatomofisiológicas do Corpo Humano I Estudo Morfofuncional do Sistema Endócrino (Glândulas Endócrinas) Unidade IV

Universidade Castelo Branco Bases Anatomofisiológicas do Corpo Humano I Estudo Morfofuncional do Sistema Endócrino (Glândulas Endócrinas) Unidade IV 1 Universidade Castelo Branco Bases Anatomofisiológicas do Corpo Humano I Estudo Morfofuncional do Sistema Endócrino (Glândulas Endócrinas) Unidade IV Visão Geral do Sistema das Glândulas Endócrinas Introdução

Leia mais

Anatomia e Fisiologia Humana

Anatomia e Fisiologia Humana Introdução Boa parte do funcionamento do corpo humano depende da comunicação entre as células por meio de mensageiros químicos que viajam pelos sangue. Conjunto de células produtoras de hormônios. Hormônios

Leia mais

BIOSSÍNTESE DE ÁCIDOS GRAXOS E REGULAÇÃO DO METABOLISMO DE GORDURAS

BIOSSÍNTESE DE ÁCIDOS GRAXOS E REGULAÇÃO DO METABOLISMO DE GORDURAS BIOSSÍNTESE DE ÁCIDOS GRAXOS E REGULAÇÃO DO METABOLISMO DE GORDURAS Se carboidratos, gorduras e proteínas são consumidas em quantidades que excedam as necessidades energéticas, o excesso será armazenado

Leia mais

Existem três tipos de glândulas: endócrinas (tireóide, suprarrenal), exócrinas (lacrimais, mamárias) e anfícrinas ou mistas (pâncreas)

Existem três tipos de glândulas: endócrinas (tireóide, suprarrenal), exócrinas (lacrimais, mamárias) e anfícrinas ou mistas (pâncreas) Existem três tipos de glândulas: endócrinas (tireóide, suprarrenal), exócrinas (lacrimais, mamárias) e anfícrinas ou mistas (pâncreas) É formado pelas glândulas endócrinas Essas tem origem no tecido epitelial

Leia mais

10/06/2013 GLÂNDULAS ENDÓCRINAS GLÂNDULAS ENDÓCRINAS (NAV) Tireóide Paratireóide Hipófise Pineal Adrenal Ilhotas pancreáticas Timo

10/06/2013 GLÂNDULAS ENDÓCRINAS GLÂNDULAS ENDÓCRINAS (NAV) Tireóide Paratireóide Hipófise Pineal Adrenal Ilhotas pancreáticas Timo UNIVERSIDADE FEDERAL DE SANTA CATARINA Campus Curitibanos Medicina Veterinária ANATOMIA II (NAV) Tireóide Paratireóide Pineal Adrenal Ilhotas pancreáticas Timo Profa. Rosane Silva glândulas de secreção

Leia mais

ENDOCRINOLOGIA REPRODUTIVA. M.S. Cássio Cassal Brauner FAEM-UFPel

ENDOCRINOLOGIA REPRODUTIVA. M.S. Cássio Cassal Brauner FAEM-UFPel ENDOCRINOLOGIA REPRODUTIVA M.S. Cássio Cassal Brauner Prof. DZ-FAEM FAEM-UFPel ENDOCRINOLOGIA REPRODUTIVA Endocrinologia é parte das ciências médicas que trata da secreção das glândulas internas (hormônios)

Leia mais

SISTEMA HIPOTÁLAMO- HIPÓFISE. Prof. Dra. Lucila L K Elias

SISTEMA HIPOTÁLAMO- HIPÓFISE. Prof. Dra. Lucila L K Elias SISTEMA HIPOTÁLAMO- HIPÓFISE Prof. Dra. Lucila L K Elias TÓPICOS Unidade hipotalâmica-hipofisária Eixos hipotálamo-hipófise-glândula-alvo Hormônios hipofisiotróficos Retroalimentação negativa Hipófise

Leia mais

Sistema Endócrino. Introdução

Sistema Endócrino. Introdução Introdução A coordenação das funções do organismo é feita pelos sistemas nervoso e endócrino. Este é formado pelo conjunto das glândulas, que produzem os hormônios, substâncias lançadas no sangue que influenciam

Leia mais

Brígida Ferrão. 10 de Outubro de 2014

Brígida Ferrão. 10 de Outubro de 2014 Brígida Ferrão 10 de Outubro de 2014 DEFINIÇÃO Sistema Endócrino conjunto de orgãos e tecidos que produzem hormonas, libertadas na corrente sanguínea e que controlam outros orgãos alvo Envelhecimento tecidos

Leia mais

Matéria: Biologia Assunto: Tecidos Animais - Tecido Epitelial Prof. Enrico Blota

Matéria: Biologia Assunto: Tecidos Animais - Tecido Epitelial Prof. Enrico Blota Matéria: Biologia Assunto: Tecidos Animais - Tecido Epitelial Prof. Enrico Blota Biologia Moléculas, células e tecidos - Tecidos animais Tecido epitelial Apresenta funções de revestimento, absorção de

Leia mais

ORGANIZAÇÃO DO SISTEMA NERVOSO FUNÇÕES BÁSICAS DAS SINAPSES E DAS SUBSTÂNCIAS TRANSMISSORAS

ORGANIZAÇÃO DO SISTEMA NERVOSO FUNÇÕES BÁSICAS DAS SINAPSES E DAS SUBSTÂNCIAS TRANSMISSORAS ORGANIZAÇÃO DO SISTEMA NERVOSO FUNÇÕES BÁSICAS DAS SINAPSES E DAS SUBSTÂNCIAS TRANSMISSORAS AULA 4 DISCIPLINA: FISIOLOGIA I PROFESSOR RESPONSÁVEL: FLÁVIA SANTOS Divisão sensorial do sistema nervoso Receptores

Leia mais

Composição e Estrutura Molecular dos Sistemas Biológicos

Composição e Estrutura Molecular dos Sistemas Biológicos Pontifícia Universidade Católica de Goiás Departamento de Biologia Prof. Hugo Henrique Pádua M.Sc. Fundamentos de Biofísica Composição e Estrutura Molecular dos Sistemas Biológicos Átomos e Moléculas Hierarquia

Leia mais

Sistema endócrino + Sistema nervoso. integração e controle das funções do organismo

Sistema endócrino + Sistema nervoso. integração e controle das funções do organismo Sistema endócrino Sistema endócrino + Sistema nervoso integração e controle das funções do organismo Sistema endócrino Conjunto de glândulas endócrinas que secretam hormônio Relembrando Glândulas que liberam

Leia mais

SISTEMA ENDÓCRINO - HORMONAL

SISTEMA ENDÓCRINO - HORMONAL SISTEMA ENDÓCRINO - HORMONAL As funções corporais são reguladas por dois grandes sistemas de controle: 1. Sist. Nervoso 2. Sist. Hormonal ou Endócrino envolvido com: - diferentes funções metabólicas -

Leia mais

Projecto Tutorial Licenciatura em Bioquímica. Hormona de crescimento GH e a. factor de transcrição Pit-1

Projecto Tutorial Licenciatura em Bioquímica. Hormona de crescimento GH e a. factor de transcrição Pit-1 Projecto Tutorial Licenciatura em Bioquímica Hormona de crescimento GH e a regulação da sua expressão pelo factor de transcrição Pit-1 Eva Cristina de Andrade Dias 1º Ano Ano Lectivo 2005/2006 Glândula

Leia mais

PÂNCREAS ENDÓCRINO. Felipe Santos Passos 2011

PÂNCREAS ENDÓCRINO. Felipe Santos Passos 2011 PÂNCREAS ENDÓCRINO Felipe Santos Passos 2011 LOCALIZAÇÃO Região epigástrica e hipocondríaca esquerda Nível de L1 L3 Transversalmente na parede posterior do abdome LOCALIZAÇÃO Retroperitoneal Relações Anatômicas:

Leia mais

Biologia. Tecido Epitelial. Professor Enrico Blota.

Biologia. Tecido Epitelial. Professor Enrico Blota. Biologia Tecido Epitelial Professor Enrico Blota www.acasadoconcurseiro.com.br Biologia TECIDO EPITELIAL (OU EPITÉLIO) Apresenta funções de revestimento, absorção de substâncias e proteção de diversas

Leia mais

Glândulas endócrinas:

Glândulas endócrinas: SISTEMA ENDOCRINO Glândulas endócrinas: Funções: Secreções de substâncias (hormônios) que atuam sobre célula alvo Regulação do organismo (homeostase) Hormônios: Substâncias químicas que são produzidas

Leia mais

SISTEMA ENDÓCRINO. Jatin Das VISÃO GERAL GLÂNDULAS ENDÓCRINAS

SISTEMA ENDÓCRINO. Jatin Das VISÃO GERAL GLÂNDULAS ENDÓCRINAS SISTEMA ENDÓCRINO Jatin Das VISÃO GERAL GLÂNDULAS ENDÓCRINAS As glândulas endócrinas mais importantes são: 1. hipófise; 2. tireóide; 3. paratireóides; 4. supra-renais; 5. ilhotas de Langerhans do pâncreas;

Leia mais

SISTEMA ENDÓCRINO hormônios tecidos alvos receptores homeostase feedback "feedback" feedback negativo" "feedback" "feedback positivo" receptores

SISTEMA ENDÓCRINO hormônios tecidos alvos receptores homeostase feedback feedback feedback negativo feedback feedback positivo receptores 1 SISTEMA ENDÓCRINO O Sistema Endócrino é constituído por diversas glândulas e tecidos que secretam substâncias químicas responsáveis pelo controle da maioria das funções biológicas. As substâncias secretadas

Leia mais

Hormônios Pancreáticos

Hormônios Pancreáticos Hormônios Pancreáticos PCI Endócrino Medicina Principais hormônios pancreáticos envolvidos no metabolismo energético: Insulina Glucagon A função principal destes hormônios é modular a disponibilidade de

Leia mais

2)Homeostasia: Constância Dinâmica. Explique esta frase. 4)Quais das seguintes substâncias são transportadas através de canais?

2)Homeostasia: Constância Dinâmica. Explique esta frase. 4)Quais das seguintes substâncias são transportadas através de canais? FISIOLOGIA HUMANA QUESTÕES DE AVALIAÇÃO PARTE I 1)Qual a relação entre a fisiologia, a homeostasia, os órgãos e as condições do ambiente interno? 2)Homeostasia: Constância Dinâmica. Explique esta frase.

Leia mais