Bases Moleculares da Obesidade e Diabetes. Hormônios e Diabetes

Save this PDF as:
 WORD  PNG  TXT  JPG

Tamanho: px
Começar a partir da página:

Download "Bases Moleculares da Obesidade e Diabetes. Hormônios e Diabetes"

Transcrição

1 Bases Moleculares da Obesidade e Diabetes Hormônios e Diabetes Prof. Carlos Castilho de Barros

2 SISTEMA ENDÓCRINO CONSISTE EM 1) Glândulas e células específicas, 2) Mensageiros químicos chamados Hormônios 3) Um órgão-alvo ou receptor.

3 As glândulas são classificadas em: Exócrina Endócrinas:

4 Hormônios (hormon = urgência) São moléculas sinalizadoras que regulam e coordenam várias funções biológicas no organismo. São substâncias químicas secretadas por uma célula ou grupo de células no sangue ou fluído extra celular, e que vão agir em um ou mais alvos, que podem estar próximos ou distantes, e onde exercem seus efeitos em baixíssimas concentrações

5 Quanto ao local de ação a atividade dos hormônios é classificada como: 1- Endócrina : alcança alvos distantes através da corrente sanguínea 2- Parácrina: atua em células ou tecidos vizinhos 3- Autócrina: age no próprio tecido ou células onde foi produzido.

6 SISTEMA NERVOSO SISTEMA ENDÓCRINO FUNÇÕES CORPORAIS

7 Hormônios produzidos em tecidos Periféricos Aparelho digestivo - estômago: gastrina grelina duodeno: Colicistocinina (CCK) Gastric inhibitory polypeptide (GIP) secretina motilina VIP íleo: enteroglucagon, Glucagon-like peptide-1 (GLP-1) fígado/outros: IGF (IGF-1, IGF-2) Tecido adiposo: leptina adiponectina resistina visfatina Ossos: osteocalcina Rim: JGA (renina) células peritubulares (eritropoietina - EPO) calcitriol prostaglandina Coração: peptídeo natriurético (atrial-anp cerebral- BNP) Músculo esquelético: irisina

8 S. NERVOSO S. Endócrino AGE RAPIDAMENTE AGE MAIS LENTAMENTE EFEITOS LOCALIZADOS E DE CURTA DURAÇÃO EFEITOS GERAIS E DE LONGA DURAÇÃO

9 HORMÔNIOS Os processos corporais geralmente estão sob controle hormonal " Controlam velocidade das reações enzimáticas " Controlam a expressão gênica e síntese de proteínas " Controlam o transporte das membranas plasmáticas através de segundos mensageiros " Induzem a atividade secretória

10 HORMÔNIOS Químicamente podem ser divididos em três classes (vertebrados): Hormônios peptídicos e proteicos: ex.: Peptídeos: TRH e vasopressina; Proteínas: insulina e hormônio do crescimento; Glicoproteínas: Hormônio luteinizante, hormônio folículoestimulante e hormônio estimulante da tireóide. Hormônios derivados de lípidos e fosfolípidos: principais são os hormônios esteróides que derivam de colesterol e os eicosanóides. Ex.: esteroides: testosterona e cortisol; Eicosanoides: prostaglandinas. Monoaminas derivados de aminoácidos aromáticos como fenilalanina, tirosina, triptofano; Ex.: adrenalina, noradrenalina; dopamina, serotonina, T3 e T4.

11 Derivados da tirosina Adrenalina Dopamina Noradrenalina Tiroxina (t4) Triiodotironina (t3) Derivados do triptofano Melatonina Serotonona

12 Esteróides Aldosterona Cortisol Estradiol Progesterona Testosterona Vitamina D

13 Peptideos Angiotensina Bradicinina Hormonio melanócito-estimulante Ocitocina Somatostatina Hormonio liberador de tireotrofina Vasopressina

14 Proteínas Adrenocorticotrofina (ACTH) Polipeptídeo pancreático Hormônio foliculo-estimulante (FSH) Hormônio liberador de gonadotrofinas (GnRH) Glucagon Fatores de crescimento semelhantes a insulina (IGFI, IGFII) Insulina Hormonio luteinizante (LH) Prolactina Hormônio paratireoideo (PTH) Hormônio do crescimento (GH) Somatotiberina (GHRH) Tireotrofina (TSH)

15

16

17 Célula Delta Célula Alfa α glucagon β insulina δ somatostatina Capilares Célula Beta PP polipeptídeo pancreático

18 Células β

19

20

21

22

23

24

25

26

27

28

29 Insulina e Sinalização

30

31 Seqüência do Receptor de Insulina Humano MGTGGRRGAAAAPLLVAVAALLLGAAGHLYPGEVCPGMDIRNNLTRLHELENCSVIEGHLQILLMFKTRPEDFR DLSFPKLIMITDYLLLFRVYGLESLKDLFPNLTVIRGSRLFFNYALVIFEMVHLKELGLYNLMNITRGSVRIEKNNEL CYLATIDWSRILDSVEDNYIVLNKDDNEECGDICPGTAKGKTNCPATVINGQFVERCWTHSHCQKVCPTICKSHG CTAEGLCCHSECLGNCSQPDDPTKCVACRNFYLDGRCVETCPPPYYHFQDWRCVNFSFCQDLHHKCKNSRR QGCHQYVIHNNKCIPECPSGYTMNSSNLLCTPCLGPCPKVCHLLEGEKTIDSVTSAQELRGCTVINGSLIINIRGG NNLAAELEANLGLIEEISGYLKIRRSALVSLSFFRKLRLIRGETLEIGNYSFYALDNQNLRQLWDWSKHNLTTTQG KLFFHYNPKLCLSEIHKMEEVSGTKGRQERNDIALKTNGDKASCENELLKFSYIRTSFDKILLRWEPYWPPDFRD LLGFMLFYKEAPYQNVTEFDGQDACGSNSWTVVDIDPPLRSNDPKSQNHPGWLMRGLKPWTQYAIFVKTLVTF SDERRTYGAKSDIIYVQTDATNPSVPLDPISVSNSSSQIILKWKPPSDPNGNITHYLVFWERQAEDSELFELDYCL KGLKLPSRTWSPPFESEDSQKHNQSEYEDSAGECCSCPKTDSQILKELEESSFRKTFEDYLHNVVFVPRKTSS GTGAEDPRPSRKRRSLGDVGNVTVAVPTVAAFPNTSSTSVPTSPEEHRPFEKVVNKESLVISGLRHFTGYRIEL QACNQDTPEERCSVAAYVSARTMPEAKADDIVGPVTHEIFENNVVHLMWQEPKEPNGLIVLYEVSYRRYGDEE LHLCVSRKHFALERGCRLRGLSPGNYSVRIRATSLAGNGSWTEPTYFYVTDYLDVPSNIAKIIIGPLIFVFLFSVVI GSIYLFLRKRQPDGPLGPLYASSNPEYLSASDVFPCSVYVPDEWEVSREKITLLRELGQGSFGMVYEGNAR DIIKGEAETRVAVKTVNESASLRERIEFLNEASVMKGFTCHHVVRLLGVVSKGQPTLVVMELMAHGDLKSYLRSL RPEAENNPGRPPPTLQEMIQMAAEIADGMAYLNAKKFVHRDLAARNCMVAHDFTVKIGDFGMTRDIYETDYYR KGGKGLLPVRWMAPESLKDGVFTTSSDMWSFGVVLWEITSLAEQPYQGLSNEQVLKFVMDGGYLDQPDNCPE RVTDLMRMCWQFNPKMRPTFLEIVNLLKDDLHPSFPEVSFFHSEENKAPESEELEMEFEDMENVPLDRSSHCQ REEAGGRDGGSSLGFKRSYEEHIPYTHMNGGKKNGRILTLPRSNPS

32 Transcrição Atividade tirosinaquinase Subunidade α Subunidade β Glicogênio Fosforilação

33 Glicose

34

35 Insulina e Metabolismo

36

37

38

39 Ácidos graxos

40 Glicogênio sintase Glicogênio fosforilase Glicoquinase Glicose6 fosfatase Frutose1,6-bisfosfatase Fosfofruto -quinase Fosfoenolpiruvatocarboxi-quinase Piruvato quinase Acetil-CoA carboxilase

41

42 DIABETES Mellitus Insulino-dependente (IDDM) Tipo I Não insulino-dependente (NIDDM) Tipo II -Normalmente acomete pessoas < 20 anos -Peso Normal -Produção de anticorpos contra as ilhotas - Inicia-se com uma insulite - Presença de atrofia e destruição das células beta -Normalmente acomete pessoas >30 anos -Obesos -Não apresentam insulite -Pequena diminuição das células beta - Diminuição dos receptores de insulina e de sua sinalização

SISTEMA ENDÓCRINO - 1 Figuras desta aula são do livro de Silverthorn

SISTEMA ENDÓCRINO - 1 Figuras desta aula são do livro de Silverthorn SISTEMA ENDÓCRINO - 1 Figuras desta aula são do livro de Silverthorn Bernardo Baldisserotto Departamento de Fisiologia e Farmacologia Universidade Federal de Santa Maria, Brasil Sistema nervoso: usualmente

Leia mais

Sistema Endócrino. Importância da endocrinologia... Introdução 17/6/2009 ROTEIRO DA AULA. Glândulas Endócrinas

Sistema Endócrino. Importância da endocrinologia... Introdução 17/6/2009 ROTEIRO DA AULA. Glândulas Endócrinas UNESP -FCAV -JABOTICABAL AGRONOMIA FISIOLOGIA DOS ANIMAIS DOMÉTICOS II Sistema Endócrino ROTEIRO DA AULA Introdução a endocrinologia Hormônios -definições, mecanismos de sinalização, química e mecanismo

Leia mais

Sinalização celular: Como as células se comunicam. Profa. Dra. Livia M. A. Tenuta

Sinalização celular: Como as células se comunicam. Profa. Dra. Livia M. A. Tenuta Sinalização celular: Como as células se comunicam Profa. Dra. Livia M. A. Tenuta Foto corpo humano Sinais fisiológicos: elétricos químicos 75 trilhões de células Tópicos a serem abordados Meios de comunicação

Leia mais

Sistema Endócrino. Objetivo da Aula. Anatomia I. Aula 10 p. 76

Sistema Endócrino. Objetivo da Aula. Anatomia I. Aula 10 p. 76 Sistema Endócrino Objetivo da Aula Compreender a divisão, forma e função do sistema endócrino. Adquirir a capacidade de aplicar este conhecimento na prática acadêmica e profissional da Educação Física.

Leia mais

FISIOLOGIA HUMANA SISTEMA ENDÓCRINO

FISIOLOGIA HUMANA SISTEMA ENDÓCRINO FISIOLOGIA HUMANA 1 SISTEMA ENDÓCRINO 2 1 Visão geral Sistema endócrino: Grupo de glândulas responsáveis por regular vários órgãos dentro do corpo; Satisfazer as necessidades de crescimento e reprodução

Leia mais

Excreção. Manutenção do equilíbrio de sal, água e remoção de excretas nitrogenadas.

Excreção. Manutenção do equilíbrio de sal, água e remoção de excretas nitrogenadas. Fisiologia Animal Excreção Manutenção do equilíbrio de sal, água e remoção de excretas nitrogenadas. Sistema urinario Reabsorção de açucar, Glicose, sais, água. Regula volume sangue ADH: produzido pela

Leia mais

Universidade Federal dos Vales do Jequitinhonha e Mucuri - UFVJM. Fisiologia Endócrina. Introdução ao Sistema Endócrino

Universidade Federal dos Vales do Jequitinhonha e Mucuri - UFVJM. Fisiologia Endócrina. Introdução ao Sistema Endócrino Universidade Federal dos Vales do Jequitinhonha e Mucuri - UFVJM Fisiologia Endócrina Introdução ao Sistema Endócrino Prof. Wagner de Fátima Pereira Departamento de Ciências Básicas Faculdade de Ciências

Leia mais

PÂNCREAS ENDÓCRINO E A REGULAÇÃO DA GLICEMIA. Prof. Hélder Mauad

PÂNCREAS ENDÓCRINO E A REGULAÇÃO DA GLICEMIA. Prof. Hélder Mauad PÂNCREAS ENDÓCRINO E A REGULAÇÃO DA GLICEMIA Prof. Hélder Mauad PÂNCREAS SOMATOSTATINA ENDÓCRINO A somatostatina é classificada como um hormônio inibitório, cujas principais ações Além são: da

Leia mais

SISTEMA ENDÓCRINO. Prof. Diego Ceolin

SISTEMA ENDÓCRINO. Prof. Diego Ceolin SISTEMA ENDÓCRINO Prof. Diego Ceolin INTRODUÇÃO Função: Atua juntamente com o sistema nervoso para o equilíbrio corporal ( Homeostase ) HOMEOSTASE Tendência permanente do organismo manter a constância

Leia mais

Embriologia e Histologia Animal II

Embriologia e Histologia Animal II Embriologia e Histologia Animal II HISTOFISIOLOGIA DO SISTEMA ENDÓCRINO Daniela dos Santos Brum Glândulas endócrinas Secretam seus produtos (moléculas biologicamente ativas) HORMÔNIOS Corrente sanguínea

Leia mais

Profº André Montillo www.montillo.com.br

Profº André Montillo www.montillo.com.br Profº André Montillo www.montillo.com.br Introdução: A célula é uma entidade isolada em sua própria membrana, bem como as suas organelas que também se encontram envoltas em sua próprias membranas, separando-as

Leia mais

SISTEMA ENDÓCRINO SISTEMA HORMONAL

SISTEMA ENDÓCRINO SISTEMA HORMONAL SISTEMA ENDÓCRINO SISTEMA HORMONAL HORMÔNIOS 1. MENSAGEIROS QUÍMICOS PRODUZIDOS PELAS GLÂNDULAS ENDÓCRINAS. 2. REGULADORES: - (ESTIMULANTES OU INIBIDORES) - (CRESCIMENTO, METABOLISMO, REPRODUÇÃO, ETC.)

Leia mais

Mensageiros Químicos. Introdução: As Comunicações entre as células: 3 Tipos de Moléculas: Receptores:

Mensageiros Químicos. Introdução: As Comunicações entre as células: 3 Tipos de Moléculas: Receptores: Introdução: A célula é uma entidade isolada em sua própria membrana, bem como as suas organelas que também se encontram envoltas em sua próprias membranas, separando-as do restante da célula. Desta forma

Leia mais

Sistema endócrino I. As células produtoras de hormônios estão geralmente reunidas em órgãos denominados glândulas endócrinas.

Sistema endócrino I. As células produtoras de hormônios estão geralmente reunidas em órgãos denominados glândulas endócrinas. RESUMO DE AULA Sistema endócrino I O funcionamento e equilíbrio fisiológico do corpo humano dependem em parte da comunicação entre as células por meio de mensageiros químicos denominados de hormônios.

Leia mais

10/09/2015. Glândula pineal. Hormônio Melatonina : produzido à noite, na ausência de luz. Crescimento; Regulação do sono; CONTROLE HORMONAL

10/09/2015. Glândula pineal. Hormônio Melatonina : produzido à noite, na ausência de luz. Crescimento; Regulação do sono; CONTROLE HORMONAL Glândulas endócrinas e tecidos que secretam hormônios; Coordena funções do organismo CONTROLE HORMONAL S. Nervoso + S. endócrino = Homeostase Mensageiros químicos; Atuam em um tecido ou órgão alvo específico;

Leia mais

INTRODUÇÃO AO ESTUDO FISIOLOGIA DI SISTEMA NERVOSO AUTONOMO. Fundamentos da organização morfo-funcional do SNA.

INTRODUÇÃO AO ESTUDO FISIOLOGIA DI SISTEMA NERVOSO AUTONOMO. Fundamentos da organização morfo-funcional do SNA. INTRODUÇÃO AO ESTUDO DA FISIOLOGIA DI SISTEMA NERVOSO AUTONOMO Fundamentos da organização morfo-funcional do SNA. Obs: O texto abaixo apresenta caráter introdutório, dessa forma, não substitui as aulas

Leia mais

Sistema endócrino. Apostila 3 Página 22

Sistema endócrino. Apostila 3 Página 22 Sistema endócrino Apostila 3 Página 22 Sistema mensageiro Hormônios: informacionais, produzidas pelas glândulas endócrinas e distribuídas pelo sangue. Órgão-alvo: reage ao estímulo do hormônio. Sistema

Leia mais

Anatomia e Fisiologia Animal Sistema Endócrino. Profa. Valdirene Zabot Unochapecó

Anatomia e Fisiologia Animal Sistema Endócrino. Profa. Valdirene Zabot Unochapecó Anatomia e Fisiologia Animal Sistema Endócrino Profa. Valdirene Zabot Unochapecó Sistema de Comunicação Corpórea: Endócrino Nervoso Produtos = Hormônios: ajudam a enviar informações para outras células

Leia mais

SISTEMA ENDÓCRINO. Prof. Me. Leandro Parussolo

SISTEMA ENDÓCRINO. Prof. Me. Leandro Parussolo SISTEMA ENDÓCRINO Prof. Me. Leandro Parussolo Sistema Endócrino Função de garantir o fluxo de informações entre diferentes cells, permitindo a integração funcional de todo o organismo; Garantir a reprodução;

Leia mais

SISTEMA ENDÓCRINO. Prof. TIAGO

SISTEMA ENDÓCRINO. Prof. TIAGO SISTEMA ENDÓCRINO Prof. TIAGO CARACTERÍSTICAS GERAIS INTEGRAÇÃO DOS SISTEMAS. CONTROLEDEATIVIDADES FISIOLOGICAS. SEMELHANTE AO SISTEMA NERVOSO. EFETUADO POR HORMÔNIOS TRANSPORTADO PELA CORRENTE SANGUINEA

Leia mais

d) uma célula é alvo apenas para um dado hormônio e) uma determinada função pode ser controlada por vários hormônios

d) uma célula é alvo apenas para um dado hormônio e) uma determinada função pode ser controlada por vários hormônios Fisiologia Endócrina - Bloco 1 de exercícios 1. O mecanismo de feedback ou retroação é o principal meio regulador da secreção das glândulas endócrinas. Um exemplo de feedback negativo é: a) aumento da

Leia mais

Sistema Endócrino. Introdução

Sistema Endócrino. Introdução Introdução A coordenação das funções do organismo é feita pelos sistemas nervoso e endócrino. Este é formado pelo conjunto das glândulas, que produzem os hormônios, substâncias lançadas no sangue que influenciam

Leia mais

Universidade Castelo Branco Bases Anatomofisiológicas do Corpo Humano I Estudo Morfofuncional do Sistema Endócrino (Glândulas Endócrinas) Unidade IV

Universidade Castelo Branco Bases Anatomofisiológicas do Corpo Humano I Estudo Morfofuncional do Sistema Endócrino (Glândulas Endócrinas) Unidade IV 1 Universidade Castelo Branco Bases Anatomofisiológicas do Corpo Humano I Estudo Morfofuncional do Sistema Endócrino (Glândulas Endócrinas) Unidade IV Visão Geral do Sistema das Glândulas Endócrinas Introdução

Leia mais

Profª Leticia Pedroso

Profª Leticia Pedroso Profª Leticia Pedroso Sistema Endócrino O homem apresenta em seu organismo várias glândulas endócrinas (glândulas que secretam hormônios para dentro do sangue). Hormônios são mensageiros químicos responsáveis

Leia mais

ANATOMIA DOS ANIMAIS DOMÉSTICOS Sistema Endócrino

ANATOMIA DOS ANIMAIS DOMÉSTICOS Sistema Endócrino ANATOMIA DOS ANIMAIS DOMÉSTICOS Sistema Endócrino O sistema nervoso e as glândulas endócrinas são os dois principais mecanismos de comunicação e coordenação do corpo humano. Eles regulam quase todos os

Leia mais

Pontifícia Universidade Católica de Goiás Departamento de Ciências Aeronáuticas. Sistema Endócrino. Prof. Raimundo Júnior M.Sc.

Pontifícia Universidade Católica de Goiás Departamento de Ciências Aeronáuticas. Sistema Endócrino. Prof. Raimundo Júnior M.Sc. Pontifícia Universidade Católica de Goiás Departamento de Ciências Aeronáuticas Sistema Endócrino Prof. Raimundo Júnior M.Sc. Sistema Hormonal atua como um sistema de controle e regulação (assim como o

Leia mais

ZOOLOGIA E HISTOLOGIA ANIMAL

ZOOLOGIA E HISTOLOGIA ANIMAL ZOOLOGIA E HISTOLOGIA ANIMAL Sistema Endócrino Prof. Fernando Stuchi Introdução Os mensageiros químicos do corpo (hormônios) são produzidos pelas glândulas endócrinas ou glândulas de secreção interna,

Leia mais

Hormônios hipotalâmicos e hipofisários. (somatostatin)

Hormônios hipotalâmicos e hipofisários. (somatostatin) Anatomia Localiza-se na base do crânio sela túrcica Hipófise anterior: derivada da bolsa de Rathke Hipófise posterior: origem neural, formada por axônios e terminções nervosas dos neurônios hipotalâmicos

Leia mais

Anatomia e Fisiologia Humana

Anatomia e Fisiologia Humana Introdução Boa parte do funcionamento do corpo humano depende da comunicação entre as células por meio de mensageiros químicos que viajam pelos sangue. Conjunto de células produtoras de hormônios. Hormônios

Leia mais

Existem três tipos de glândulas: endócrinas (tireóide, suprarrenal), exócrinas (lacrimais, mamárias) e anfícrinas ou mistas (pâncreas)

Existem três tipos de glândulas: endócrinas (tireóide, suprarrenal), exócrinas (lacrimais, mamárias) e anfícrinas ou mistas (pâncreas) Existem três tipos de glândulas: endócrinas (tireóide, suprarrenal), exócrinas (lacrimais, mamárias) e anfícrinas ou mistas (pâncreas) É formado pelas glândulas endócrinas Essas tem origem no tecido epitelial

Leia mais

Capacidade de organizar os produtos da digestão usando a energia extraída dos mesmos produtos da digestão (REGULAÇÃO)

Capacidade de organizar os produtos da digestão usando a energia extraída dos mesmos produtos da digestão (REGULAÇÃO) Capacidade de organizar os produtos da digestão usando a energia extraída dos mesmos produtos da digestão (REGULAÇÃO) As proteínas são digeridas até aminoácidos, as gorduras (triglicérides) até glicerol

Leia mais

Fisiologia do Sistema Endócrino e o papel da Melatonina

Fisiologia do Sistema Endócrino e o papel da Melatonina Liga Acadêmica de Farmacologia Fisiologia do Sistema Endócrino e o papel da Melatonina Prof. Dr. Luiz Carlos dos Reis Melatonin, human aging, and age-related diseases M Karaseka Experimental Gerontology

Leia mais

Projecto Tutorial Licenciatura em Bioquímica. Hormona de crescimento GH e a. factor de transcrição Pit-1

Projecto Tutorial Licenciatura em Bioquímica. Hormona de crescimento GH e a. factor de transcrição Pit-1 Projecto Tutorial Licenciatura em Bioquímica Hormona de crescimento GH e a regulação da sua expressão pelo factor de transcrição Pit-1 Eva Cristina de Andrade Dias 1º Ano Ano Lectivo 2005/2006 Glândula

Leia mais

10/06/2013 GLÂNDULAS ENDÓCRINAS GLÂNDULAS ENDÓCRINAS (NAV) Tireóide Paratireóide Hipófise Pineal Adrenal Ilhotas pancreáticas Timo

10/06/2013 GLÂNDULAS ENDÓCRINAS GLÂNDULAS ENDÓCRINAS (NAV) Tireóide Paratireóide Hipófise Pineal Adrenal Ilhotas pancreáticas Timo UNIVERSIDADE FEDERAL DE SANTA CATARINA Campus Curitibanos Medicina Veterinária ANATOMIA II (NAV) Tireóide Paratireóide Pineal Adrenal Ilhotas pancreáticas Timo Profa. Rosane Silva glândulas de secreção

Leia mais

Brígida Ferrão. 10 de Outubro de 2014

Brígida Ferrão. 10 de Outubro de 2014 Brígida Ferrão 10 de Outubro de 2014 DEFINIÇÃO Sistema Endócrino conjunto de orgãos e tecidos que produzem hormonas, libertadas na corrente sanguínea e que controlam outros orgãos alvo Envelhecimento tecidos

Leia mais

Sistema endócrino + Sistema nervoso. integração e controle das funções do organismo

Sistema endócrino + Sistema nervoso. integração e controle das funções do organismo Sistema endócrino Sistema endócrino + Sistema nervoso integração e controle das funções do organismo Sistema endócrino Conjunto de glândulas endócrinas que secretam hormônio Relembrando Glândulas que liberam

Leia mais

Os hormônios não são os únicos sinalizadores intercelulares.

Os hormônios não são os únicos sinalizadores intercelulares. 6. O que são e para que servem os hormônios? Introdução Em 1902, Bayliss e Starling verificaram que, em resposta à introdução de substâncias ácidas, a mucosa do duodeno e do jejuno liberava um mensageiro

Leia mais

CONTROLE E INTEGRAÇÂO

CONTROLE E INTEGRAÇÂO CONTROLE E INTEGRAÇÂO A homeostase é atingida através de uma série de mecanismos reguladores que envolve todos os órgãos do corpo. Dois sistemas, entretanto, são destinados exclusivamente para a regulação

Leia mais

SISTEMA ENDÓCRINO - HORMONAL

SISTEMA ENDÓCRINO - HORMONAL SISTEMA ENDÓCRINO - HORMONAL As funções corporais são reguladas por dois grandes sistemas de controle: 1. Sist. Nervoso 2. Sist. Hormonal ou Endócrino envolvido com: - diferentes funções metabólicas -

Leia mais

Glândulas endócrinas:

Glândulas endócrinas: SISTEMA ENDOCRINO Glândulas endócrinas: Funções: Secreções de substâncias (hormônios) que atuam sobre célula alvo Regulação do organismo (homeostase) Hormônios: Substâncias químicas que são produzidas

Leia mais

SISTEMA ENDÓCRINO hormônios tecidos alvos receptores homeostase feedback "feedback" feedback negativo" "feedback" "feedback positivo" receptores

SISTEMA ENDÓCRINO hormônios tecidos alvos receptores homeostase feedback feedback feedback negativo feedback feedback positivo receptores 1 SISTEMA ENDÓCRINO O Sistema Endócrino é constituído por diversas glândulas e tecidos que secretam substâncias químicas responsáveis pelo controle da maioria das funções biológicas. As substâncias secretadas

Leia mais

SISTEMA HIPOTÁLAMO- HIPÓFISE. Prof. Dra. Lucila L K Elias

SISTEMA HIPOTÁLAMO- HIPÓFISE. Prof. Dra. Lucila L K Elias SISTEMA HIPOTÁLAMO- HIPÓFISE Prof. Dra. Lucila L K Elias TÓPICOS Unidade hipotalâmica-hipofisária Eixos hipotálamo-hipófise-glândula-alvo Hormônios hipofisiotróficos Retroalimentação negativa Hipófise

Leia mais

Sistema Endócrino II - Hormônios

Sistema Endócrino II - Hormônios Ciências Morfofuncionais III Sistema Endócrino II - Hormônios Natureza, química e funções Professores: Felipe, Jean-Pierre e Olivia Endocrinologia Estudo das secreções internas do organismo Hormônios São

Leia mais

Disciplina de Fisiologia Veterinária. GH e PROLACTINA. Prof. Fabio Otero Ascoli

Disciplina de Fisiologia Veterinária. GH e PROLACTINA. Prof. Fabio Otero Ascoli Disciplina de Fisiologia Veterinária GH e PROLACTINA Prof. Fabio Otero Ascoli GH Sinônimos: Hormônio do crescimento ou somatotrópico ou somatotropina Histologia: Em torno de 30 a 40% das células da hipófise

Leia mais

Fisiologia do Sistema Endócrino-I

Fisiologia do Sistema Endócrino-I Curso Preparatório para Residência em Enfermagem-2012 Fisiologia do Sistema Endócrino-I Prof. Fernando Ramos Gonçalves -Msc Glândulas endócrinas: Funções: Secreções de substâncias (hormônios) que atuam

Leia mais

Bases Moleculares da Obesidade e Diabetes Sistema Nervoso Autônomo Prof. Carlos Castilho de Barros

Bases Moleculares da Obesidade e Diabetes Sistema Nervoso Autônomo Prof. Carlos Castilho de Barros Bases Moleculares da Obesidade e Diabetes Sistema Nervoso Autônomo Prof. Carlos Castilho de Barros http://wp.ufpel.edu.br/obesidadediabetes/ Sistema Nervoso Sistema Nervoso Central Sistema Nervoso Periférico

Leia mais

Diversidade do sistema endócrino

Diversidade do sistema endócrino Diversidade do sistema endócrino Importância Biomédica - hormônio palavra de origem grega despertar para a atividade - Definição clássica Conceito célula alvo - ação bioquímica ou fisiológica Importância

Leia mais

SISTEMA ENDÓCRINO. Jatin Das VISÃO GERAL GLÂNDULAS ENDÓCRINAS

SISTEMA ENDÓCRINO. Jatin Das VISÃO GERAL GLÂNDULAS ENDÓCRINAS SISTEMA ENDÓCRINO Jatin Das VISÃO GERAL GLÂNDULAS ENDÓCRINAS As glândulas endócrinas mais importantes são: 1. hipófise; 2. tireóide; 3. paratireóides; 4. supra-renais; 5. ilhotas de Langerhans do pâncreas;

Leia mais

Sistema Endócrino: controle hormonal

Sistema Endócrino: controle hormonal Sistema Endócrino: controle hormonal Todos os processos fisiológicos estudados até agora, como digestão, respiração, circulação e excreção, estão na dependência do sistema que fabrica os hormônios. O sistema

Leia mais

Células A (25%) Glucagon Células B (60%) Insulina Células D (10%) Somatostatina Células F ou PP (5%) Polipeptídeo Pancreático 1-2 milhões de ilhotas

Células A (25%) Glucagon Células B (60%) Insulina Células D (10%) Somatostatina Células F ou PP (5%) Polipeptídeo Pancreático 1-2 milhões de ilhotas Instituto Biomédico Departamento de Fisiologia e Farmacologia Disciplina: Fisiologia II Curso: Medicina Veterinária Pâncreas Endócrino Prof. Guilherme Soares Ilhotas Células A (25%) Glucagon Células B

Leia mais

FISIOLOGIA DO EIXO HIPOTÁLAMO- HIPOFISÁRIO

FISIOLOGIA DO EIXO HIPOTÁLAMO- HIPOFISÁRIO FISIOLOGIA DO EIXO - HIPOFISÁRIO Letícia Lotufo Histórico: Sec. XI d.c. Galeno - primeiras evidências da associação íntima entre o hipotálamo e a hipófise 1920 Lewi & Greving Identificação do trato hipotalâmico-hipofisário

Leia mais

Sistema Endócrino Sistema Endócrino Sistema Endócrino Sistema Endócrino Sistema Endócrino Sistema Endócrino Mensagem Química: Hormônios Os hormônios são substâncias químicas liberadas na corrente sanguínea

Leia mais

Hipófise (ou glândula Pituitária)

Hipófise (ou glândula Pituitária) Sistema Hormonal Sistema Hormonal O sistema endócrino é formado pelo conjunto de glândulas endócrinas, as quais são responsáveis pela secreção de substância denominadas hormonas. As glândulas endócrinas

Leia mais

Glândulas e hormônios. Profª Talita Silva Pereira

Glândulas e hormônios. Profª Talita Silva Pereira Glândulas e hormônios Profª Talita Silva Pereira O sistema endócrino É formado pelo conjunto de glândulas endócrinas, as quais são responsáveis pela secreção de substância denominadas hormônios. As glândulas

Leia mais

EIXO HIPOTÁLAMO HIPOFISÁRIO

EIXO HIPOTÁLAMO HIPOFISÁRIO EIXO HIPOTÁLAMO HIPOFISÁRIO ESTRUTURA ANATÔMICA DO EIXO HIPOTÁLAMO-HIPOFISÁRIO Núcleo Núcleo supraóptico Quiasma óptico Adenohipófise paraventricular Hipotálamo Infundíbulo Haste hipotálamohipofisária

Leia mais

ZOOLOGIA E HISTOLOGIA ANIMAL

ZOOLOGIA E HISTOLOGIA ANIMAL ZOOLOGIA E HISTOLOGIA ANIMAL Sistema Endócrino Prof. Fernando Stuchi Introdução à Endocrinologia As múltiplas atividades das células, tecidos e órgãos do corpo são coordenadas pelo inter-relacionamento

Leia mais

Hormonas e mensageiros secundários

Hormonas e mensageiros secundários Hormonas e mensageiros secundários Interrelação entre os tecidos Comunicação entre os principais tecidos Fígado tecido adiposo hormonas sistema nervoso substratos em circulação músculo cérebro 1 Um exemplo

Leia mais

Lista de Exercícios. Aluno(a): Nº. Pré Universitário Uni-Anhanguera. Disciplina: Biologia

Lista de Exercícios. Aluno(a): Nº. Pré Universitário Uni-Anhanguera. Disciplina: Biologia Lista de Exercícios Pré Universitário Uni-Anhanguera Aluno(a): Nº. Professor: Mário Neto Série: 2 Ano Disciplina: Biologia 1) (Fuvest-1998) Uma jovem que sempre foi saudável chegou a um hospital em estado

Leia mais

Sistema Endócrino. Hormônios. Eixo hipotalâmico-hipofisário. Formas de Ação. Msc. Ana Maria da Silva Curado Lins

Sistema Endócrino. Hormônios. Eixo hipotalâmico-hipofisário. Formas de Ação. Msc. Ana Maria da Silva Curado Lins Hormônios Sistema Endócrino Msc. Ana Maria da Silva Curado Lins Substância produzida em diminutas quantidades, em células especiais (glândulas) que circulam pela corrente sanguínea (ação endócrina) e agem

Leia mais

REGULAÇÃO HOMEOSTÁTICA DO VOLUME E OSMOLALIDADE. Prof. Dra. Lucila LK Elias

REGULAÇÃO HOMEOSTÁTICA DO VOLUME E OSMOLALIDADE. Prof. Dra. Lucila LK Elias REGULAÇÃO HOMEOSTÁTICA DO VOLUME E OSMOLALIDADE DOS LÍQUIDOS CORPORAIS Prof. Dra. Lucila LK Elias TÓPICOS: Definição de Homeostase Compartimentos dos Líquidos Corporais Hipófise posterior: controle da

Leia mais

SISTEMA ENDÓCRINO. Ornólia Paracampos

SISTEMA ENDÓCRINO. Ornólia Paracampos SISTEMA ENDÓCRINO Ornólia Paracampos CARACTERÍSTICAS Sistema de regulação e integração de funções O mediador químico é um hormônio Alcança o alvo via sangue Aã Ação mais lenta e mais duradoura d São glândulas

Leia mais

Inseminação Artificial em Tempo Fixo (IATF) Em Bovinos Leiteiros

Inseminação Artificial em Tempo Fixo (IATF) Em Bovinos Leiteiros Gado de Leite 1/35 Inseminação Artificial em Tempo Fixo (IATF) Em Bovinos Leiteiros Erick Fonseca de Castilho Doutor em Reprodução Animal (UFV/MG) efcmv@yahoo.com.br 2/35 Introdução Cronologia dos conceitos

Leia mais

Fisiologia do sistema endócrino: hipotálamo e hipófise

Fisiologia do sistema endócrino: hipotálamo e hipófise Fisiologia do sistema endócrino: hipotálamo e hipófise Prof. Kellen Brunaldi Universidade Estadual de Maringá, Departamento de Ciências Fisiológicas Curso: Odontologia Silverthorn, Capítulo 7. Roteiro

Leia mais

Exercícios de Coordenação Endócrina

Exercícios de Coordenação Endócrina Exercícios de Coordenação Endócrina 1. (UFABC) Leia a tirinha: Material de apoio do Extensivo Enquanto o futuro não chega, diabéticos controlam a glicemia através de injeções diárias de insulina ou mesmo

Leia mais

Estrutura adrenal. Função da medula adrenal. Função da medula adrenal. Funções do córtex adrenal. Funções do córtex adrenal. Funções do córtex adrenal

Estrutura adrenal. Função da medula adrenal. Função da medula adrenal. Funções do córtex adrenal. Funções do córtex adrenal. Funções do córtex adrenal Estrutura adrenal Função da medula adrenal O córtex compreende a zona glomerulosa, secretora dos minelocorticóides, e a zona reticulada, secretora de glicocorticóides e dos androgênios adrenais. A medula

Leia mais

EIXO HIPOTÁLAMO- HIPÓFISE

EIXO HIPOTÁLAMO- HIPÓFISE Centro de Ciências da Vida Faculdade de Ciências Biológicas EIXO HIPOTÁLAMO- HIPÓFISE Prof. Dr. Alexandre Rezende O Sistema Hormonal tem uma estreita relação com o sistema nervoso, através do hipotálamo.

Leia mais

LICENCIATURA EM ENGª DA PRODUÇÃO ANIMAL ENDOCRINOLOGIA MECANISMO DE ACÇÃO HORMONAL DOCENTE RESPONSÁVEL PAULA AZEVEDO paula.azevedo@esa.ipsantarem.pt 1 MECANISMO DE ACÇÃO HORMONAL Glândula endócrina glândula

Leia mais

Sinalização celular. Profa. Dra. Monica Akemi Sato

Sinalização celular. Profa. Dra. Monica Akemi Sato Sinalização celular Profa. Dra. Monica Akemi Sato Mensageiros Químicos Número de células Corpo Humano ~75 trilhões As células são especializadas na execução da função específica Ex: secreção ou contração.

Leia mais

3) (UFABC/2009) Leia a tirinha:

3) (UFABC/2009) Leia a tirinha: Lista de Exercícios Pré Universitário Uni-Anhanguera Aluno(a): Nº. Professor: Mário Neto Série: 2 Ano Disciplina: Biologia 11) (Fuvest-1998) Uma jovem que sempre foi saudável chegou a um hospital em estado

Leia mais

Tema 07: Glândulas Endócrinas

Tema 07: Glândulas Endócrinas Universidade Federal do Amazonas ICB Dep. Morfologia Disciplina: Tópicos Especiais para Biotecnologia Tema 07: Glândulas Endócrinas Função Produção de hormônios; 1 Constituição Controle da homeostase;

Leia mais

FISIOLOGIA DO EIXO HIPOTÁLAMO- HIPOFISÁRIO

FISIOLOGIA DO EIXO HIPOTÁLAMO- HIPOFISÁRIO FISIOLOGIA DO EIXO HIPOTÁLAMO- HIPOFISÁRIO Letícia Lotufo Histórico: Sec. XI d.c. Galeno - primeiras evidências da associação íntima entre o hipotálamo e a hipófise 1920 Lewi & Greving Identificação do

Leia mais

29/03/2012. Biologia. Principais glândulas endócrinas humanas

29/03/2012. Biologia. Principais glândulas endócrinas humanas Biologia Tema: Módulo 01: Anatomia e fisiologia Marcos Vinícius Introdução É um sistema que juntamente com o sistema nervoso atua no controle das funções gerais do nosso organismo. É representado pelos

Leia mais

ZONA DE SOBREVIVÊNCIA. Conforto Térmico. Gráfico 1: Variações da temperatura corporal de um animal homeotérmico em função da temperatura ambiente.

ZONA DE SOBREVIVÊNCIA. Conforto Térmico. Gráfico 1: Variações da temperatura corporal de um animal homeotérmico em função da temperatura ambiente. ZONA DE SOBREVIVÊNCIA Hipotermia HOMEOTERMIA Homeotermia (HOMEOSTASIA) Hipertermia ou Homeostasia Termogênese Termoneutralidade Zona de Conforto Térmico Temperatura corporal TI TCIn Zona de TCS Termoneutralidade

Leia mais

SISTEMA ENDÓCRINO PROFESSOR CLERSON

SISTEMA ENDÓCRINO PROFESSOR CLERSON SISTEMA ENDÓCRINO PROFESSOR CLERSON CARACTERÍSTICAS FUNCIONAMENTO DO CORPO COMUNICAÇÃO COM CÉLULAS: AÇÃO HORMONAL LIBERAÇÃO POR DETERMINADAS CÉLULAS GLÂNDULAS ENDÓCRINAS: CÉLULAS PRODUTORAS DE HORMÔNIOS

Leia mais

ORGANIZAÇÃO MORFOLÓGICA E FUNCIONAL DO SISTEMA HIPOTALÂMICO HIPOFISÁRIO

ORGANIZAÇÃO MORFOLÓGICA E FUNCIONAL DO SISTEMA HIPOTALÂMICO HIPOFISÁRIO ORGANIZAÇÃO MORFOLÓGICA E FUNCIONAL DO SISTEMA HIPOTALÂMICO HIPOFISÁRIO Laboratório de Neuroendocrinologia Prof. Dr. Celso Rodrigues Franci Fernanda Barbosa Lima Os sistemas nervoso e endócrino regulam

Leia mais

SISTEMA ENDÓCRINO. Prof. André Maia

SISTEMA ENDÓCRINO. Prof. André Maia SISTEMA ENDÓCRINO O sistema endócrino e formado pelo conjunto de glândulas endócrinas, as quais são responsáveis pela secreção de substancias denominadas hormônios. As glândulas endócrinas (do grego endos,

Leia mais

Sinalização Celular. Por que sinalizar?

Sinalização Celular. Por que sinalizar? Comunicação Celular Sinalização Celular Por que sinalizar? Sinalização Celular Quando sinalizar? Sinalização Celular Como sinalizar? Sinalização Celular Onde sinalizar? Relevância Biológica Alteração no

Leia mais

ALTERAÇÕES METABÓLICAS NA GRAVIDEZ

ALTERAÇÕES METABÓLICAS NA GRAVIDEZ ALTERAÇÕES METABÓLICAS NA GRAVIDEZ CUSTO ENERGÉTICO DA GRAVIDEZ CRESCIMENTO E DESENVOLVIMENTO FETAL SÍNTESE DE TECIDO MATERNO 80.000 kcal ou 300 Kcal por dia 2/4 médios 390 Kcal depósito de gordura- fase

Leia mais

CONTROLE ENDÓCRINO DO DESENVOLVIMENTO

CONTROLE ENDÓCRINO DO DESENVOLVIMENTO CONTROLE ENDÓCRINO DO CRESCIMENTO E DESENVOLVIMENTO Lucila LK Elias Prof. Dra. Lucila LK Elias TÓPICOS Fatores envolvidos no processo de crescimento e Desenvolvimento Curvas de crescimento Principais Fatores

Leia mais

Sistema Endócrino É UM SISTEMA SOFISTICADO E SENSÍVEL FORMADO POR VÁRIOS ÓRGÃOS OU

Sistema Endócrino É UM SISTEMA SOFISTICADO E SENSÍVEL FORMADO POR VÁRIOS ÓRGÃOS OU SISTEMA ENDRÓCRINO Sistema Endócrino É UM SISTEMA SOFISTICADO E SENSÍVEL FORMADO POR VÁRIOS ÓRGÃOS OU GLÂNDULAS DIFERENTES QUE SECRETAM HORMÔNIOS. OS HORMÔNIOS SÃO MENSAGEIROS QUÍMICOS,GERALMENTE TRANSPORTADOS

Leia mais

Aula 23 Sistema endócrino

Aula 23 Sistema endócrino Aula 23 Sistema endócrino O sistema endócrino é formado por órgãos e tecidos que secretam hormônios. Os hormônios são lançados na corrente sangüínea e influenciam a atividade de células, órgãos ou sistemas.

Leia mais

MECANISMOS DA AÇÃO HORMONAL *

MECANISMOS DA AÇÃO HORMONAL * MECANISMOS DA AÇÃO HORMONAL * Introdução As várias funções do organismo devem ser capazes de responder, de forma coordenada e apropriada, a diversas modificações físicas e químicas, provenientes de dentro

Leia mais

Teste para a Pesquisa de Receptores Hormonais Ilícitos nas Glândulas Supra- Renais Contra-indicações à realização do teste:

Teste para a Pesquisa de Receptores Hormonais Ilícitos nas Glândulas Supra- Renais Contra-indicações à realização do teste: Teste para a Pesquisa de Receptores Hormonais Ilícitos nas Glândulas Supra- Renais O teste consiste na dosagem dos níveis séricos de cortisol e ACTH, após um estímulo hormonal ou farmacológico in vivo

Leia mais

II.4 - Histofisiologia dos Epitélios Glandulares:

II.4 - Histofisiologia dos Epitélios Glandulares: Capítulo 1: Parte 3 1 II.4 - Histofisiologia dos Epitélios Glandulares: O epitélio que participa principalmente da secreção está geralmente disposto em estruturas denominadas glândulas. As substâncias

Leia mais

Glândula tireóide: Sistema Endócrino Hormônios da Tireóide. Glândula Tireóide. Glândula tireóide: Msc. Ana Maria da Silva Curado Lins

Glândula tireóide: Sistema Endócrino Hormônios da Tireóide. Glândula Tireóide. Glândula tireóide: Msc. Ana Maria da Silva Curado Lins Sistema Endócrino Hormônios da Tireóide Msc. Ana Maria da Silva Curado Lins Glândula tireóide: localiza-se imediatamente abaixo da laringe e anteriormente à traquéia sendo esta uma das maiores glândulas

Leia mais

22.05. O tipo básico de tecido epitelial é o de revestimento sendo os demais tecidos epiteliais (glandular e neuroepitélio) derivados desse.

22.05. O tipo básico de tecido epitelial é o de revestimento sendo os demais tecidos epiteliais (glandular e neuroepitélio) derivados desse. BIO 8E aula 22 22.01. O tecido epitelial de revestimento é pobre em substância intercelular e avascular. Existe também o tecido epitelial glandular que é derivado do tecido epitelial de revestimento. O

Leia mais

Sistema neuro-hormonal

Sistema neuro-hormonal Sistema neuro-hormonal O que é o sistema neuro-hormonal? Qualquer alteração no exterior ou no interior do corpo corresponde a um Estímulo que provoca uma resposta do sistema neurohormonal. Como funciona

Leia mais

Fisiologia da glândula Tireóide

Fisiologia da glândula Tireóide Universidade Federal do Espírito Santo PSICOLOGIA Fisiologia da glândula Tireóide Élio Waichert Júnior Localização anatômica Secreta 3 Hormônios: Tiroxina (T4) Triiodotironina (T3) Calcitonina Prof. Élio

Leia mais

UNIDADE 7 SINALIZAÇÃO CELULAR

UNIDADE 7 SINALIZAÇÃO CELULAR UNIDADE 7 SINALIZAÇÃO CELULAR 1. VISÃO GERAL A sinalização celular é um mecanismo de comunicação entre as células que se encontra presente nas mais diversas formas de vida, desde organismos unicelulares,

Leia mais

Metabolismo dos Carboidratos

Metabolismo dos Carboidratos Metabolismo dos Carboidratos síntese de glicogênio a partir da glicose Glicogenólise síntese de glicose a partir do glicogênio Lipogênese excesso de glicose convertido em gordura Prof. M.Sc. Renata Fontes

Leia mais

Hipófise. 1.1. Relações anatômicas. Hipotálamo interface entre os sistemas nervoso e endócrino. Remoção cirúrgica morte 1 a 2 dias

Hipófise. 1.1. Relações anatômicas. Hipotálamo interface entre os sistemas nervoso e endócrino. Remoção cirúrgica morte 1 a 2 dias 1. CARACTERÍSTICAS GERAIS DO SISTEMA HIPOTÂMICO HIPÓFISÁRIO 1.1. Relações anatômicas Hipófise Hipotálamo interface entre os sistemas nervoso e endócrino Infundíbulo Controla a função hipofisária através

Leia mais

Sistemas endocrinos (www.reproducao.ufc.br)

Sistemas endocrinos (www.reproducao.ufc.br) Sistemas endocrinos (www.reproducao.ufc.br) Glandulas Hormonios e receptores Celulas ou tecido alvo Mecanismos de acao intracelular Respostas fisiologicas Sistemas de auto-regulacao ou "feedback" 3/28/2007

Leia mais

TIREÓIDE E PARATIREÓIDE

TIREÓIDE E PARATIREÓIDE Disciplina de Fisiologia Veterinária TIREÓIDE E PARATIREÓIDE Prof. Fabio Otero Ascoli Localização: TIREÓIDE Caudalmente à traquéia, na altura do primeiro ou segundo anel traqueal Composição: Dois lobos,

Leia mais

HIPOTÁLAMO E HIPÓFISE. Introdução à Endocrinologia

HIPOTÁLAMO E HIPÓFISE. Introdução à Endocrinologia HIPOTÁLAMO E HIPÓFISE Introdução à Endocrinologia GENERALIDADES SOBRE HORMÔNIOS CONCEITO Hormônios são substâncias que funcionam como mensageiras inter-celulares CLASSIFICAÇÃO DOS HORMÔNIOS PROTÉICOS Formados

Leia mais

Biologia. Aulas 33, 34 e 35 Setor B. Prof. Rafa

Biologia. Aulas 33, 34 e 35 Setor B. Prof. Rafa Biologia Aulas 33, 34 e 35 Setor B Prof. Rafa Tipos de glândulas: Exócrinas: com ducto de saída lacrimais, mamárias, salivares, sebáceas e sudoríparas Endócrinas: sem ducto de saída, secreções (hormônios)

Leia mais

LABORATÓRIO DE HORMÔNIOS E GENÉTICA MOLECULAR LIM/42 DISCIPLINA DE ENDOCRINOLOGIA PAMB-2º ANDAR BLOCO 6

LABORATÓRIO DE HORMÔNIOS E GENÉTICA MOLECULAR LIM/42 DISCIPLINA DE ENDOCRINOLOGIA PAMB-2º ANDAR BLOCO 6 LABORATÓRIO DE HORMÔNIOS E GENÉTICA MOLECULAR LIM/42 DISCIPLINA DE ENDOCRINOLOGIA PAMB-2º ANDAR BLOCO 6 Tel da recepção do Laboratório: 3069-6148 Tel secretaria do Laboratório: 30697512 Acesso ao manual

Leia mais

PUBERDADE. Fase fisiológica com duração de 2 a 5 anos, durante a qual ocorre a maturação sexual

PUBERDADE. Fase fisiológica com duração de 2 a 5 anos, durante a qual ocorre a maturação sexual Puberdade PUBERDADE Transição entre a infância e a vida adulta Transformações físicas e psíquicas complexas Fase fisiológica com duração de 2 a 5 anos, durante a qual ocorre a maturação sexual Desenvolvimento

Leia mais

Fisiologia humana 0 (parte IV) Hormônios e reprodução. Natália A. Paludetto nataliaapaludetto@gmail.com http://proenem.sites.ufms.

Fisiologia humana 0 (parte IV) Hormônios e reprodução. Natália A. Paludetto nataliaapaludetto@gmail.com http://proenem.sites.ufms. Fisiologia humana 0 (parte IV) Hormônios e reprodução Natália A. Paludetto nataliaapaludetto@gmail.com http://proenem.sites.ufms.br/ Sistema Endócrino Composto pelas glândulas endócrinas integra e regula

Leia mais