Introdução a Banco de Dados. Tópicos. Definições. Definições Arquitetura Modelo/Esquema Histórico Aplicações Típicas. Fernanda Baião UNIRIO

Tamanho: px
Começar a partir da página:

Download "Introdução a Banco de Dados. Tópicos. Definições. Definições Arquitetura Modelo/Esquema Histórico Aplicações Típicas. Fernanda Baião UNIRIO"

Transcrição

1 Introdução a Banco de Dados Fernanda Baião UNIRIO Material extraído a partir das notas de aula de Maria Luiza M. Campos e Maria Cláudia Cavalcanti 1 Tópicos Definições Arquitetura Modelo/Esquema Histórico Aplicações Típicas 2 Definições DADOS x INFORMAÇÃO x CONHECIMENTO Dados: conjunto de valores Ex.: Matriz de valores contendo as quantidades de produtos em estoque Informação: dados associados a seu significado Ex.: Matriz com valores e o significado de cada coluna. Coluna 1 = nome do produto Coluna 2 = quantidade em estoque Conhecimento: há um entendimento sobre o significado dos dados e é possível extrair conhecimento a partir dos mesmos Ex: Se tenho abaixo de um dado limite em estoque vou precisar repor o produto 3

2 Definições Base de Dados Representação é livre Arquivos texto (flat files) Às vezes provê informação Banco de Dados Obrigatoriamente provê informação Dados são representados segundo um padrão Pressupõe um sistema de gerenciamento Gerência de Dados Suporte à extração do conhecimento a partir de bancos de dados Suporte à manipulação dos dados, garantindo consistência e integridade dos dados SGBDs: Sistemas de Gerência de Bancos de Dados 4 Base de Dados - GenBank LOCUS SCU bp DNA PLN 21-JUN-1999 DEFINITION Saccharomyces cerevisiae TCP1-beta gene, partial cds, and Axl2p (AXL2) and Rev7p (REV7) genes, complete cds. ACCESSION U49845 VERSION U GI: KEYWORDS. SOURCE Saccharomyces cerevisiae (baker's yeast) ORGANISM Saccharomyces cerevisiae Eukaryota; Fungi; Ascomycota; Saccharomycotina; Saccharomycetes; Saccharomycetales; Saccharomycetaceae; Saccharomyces. REFERENCE 1 (bases 1 to 5028) AUTHORS Torpey,L.E., Gibbs,P.E., Nelson,J. and Lawrence,C.W. TITLE Cloning and sequence of REV7, a gene whose function is required for DNA damage-induced mutagenesis in Saccharomyces cerevisiae JOURNAL Yeast 10 (11), (1994) MEDLINE PUBMED FEATURES Location/Qualifiers CDS < /codon_start=3 /product="tcp1-beta" /protein_id="aaa " /db_xref="gi: " /translation="ssiyngistsgldlnngtiadmrqlgivesyklkravvssasea AEVLLRVDNIIRARPRTANRQHM" gene /gene="axl2" 5 Banco de Dados - GUS DB 6

3 Gerência de dados DADOS capturar gerenciar visualizar armazena r analisa r 7 Sistema Tradicional de Arquivos Emissão de Guias de Cobrança Emissão de Contas a Pagar Emissão de Ordens de Fornecimento Cadastro cadastro de de Clientes clientes Contas a Receber Cadastro cadastro de de Cadastro de Fornecedores clientes Itens Emissão de Pedidos de Compra Cadastro cadastro de de Cadastro de Fornecedores clientes Pedidos Contas a Pagar Folha de Pagamento Cadastro de Clientes Cadastro de Itens Cadastro de Funcionários 8 Limitações Dados isolados e em diferentes arquivos Registros incompatíveis Duplicação de dados Programas dependentes dos dados Dificuldade de representar o todo (a realidade do usuário) 9

4 Sistema Gerenciador de Banco de Dados Emissão de Emissão de Emissão de Guias de Cobrança Contas a Pagar Ordens de Fornecimento Emissão de Pedidos de Compra Folha de Pagamento SGBD Contas a Receber Contas a Pagar Cadastro de Clientes Cadastro de Itens Cadastro de Pedidos Cadastro de Fornecedores Cadastro de Funcionários 10 Vantagens Dados integrados e compartilhados Suporte a múltiplas visões dos dados Duplicação de dados controlada Independência de dados Representação mais próxima da percepção do usuário 11 O Que é Banco de Dados? Coleção auto-descritiva de registros integrados Inclui a definição de sua própria estrutura Contém dados do usuário, índices e dados sobre sua utilização (usuários, aplicativos, estatísticas) 12

5 Dados ESTUDANTE Matrícula Nome Telefone Orientador José Maria da Silva Arnaldo Vieira Maria Cláudia Araujo Pedro Nascimento Carlos Manoel Soares Maria Luiza Campos Armando Gomes Maria Luiza Campos Carla Ferrentini Arnaldo Vieira 13 Metadados Dados sobre dados Permitem a manutenção, representação e identificação dos dados Garantem a consistência e a persistência das definições das unidades de dados Proporcionam aos usuários um entendimento comum das unidades de dados 14 Metadados SysTables SysColumns Table Name Number of Columns Primary Key Column Name Table Name Data Type Length Estudante 4 Matrícula Matrícula Estudante Integer 4 Disciplina 5 Código Nome Estudante Text 30 Matrícula 3 Nome + Código Telefone Estudante Text 10 Orientador 5 Identidade Orientador Estudante Text 30 Alguns autores/implementações de SGBD chamam de catálogo. 15

6 Índices Estruturas auxiliares para permitir um acesso mais direto a um dado ou conjunto de dados ÍNDICE 1 Orientador Arnaldo Vieira Arnaldo Vieira Maria Luiza Campos Maria Luiza Campos Pedro Nascimento Matrícula Metadados de Aplicações Armazena a estrutura e o formato de formulários, relatórios, consultas e outros componentes da aplicação Nem todos os SGBDs suportam componentes de aplicações Dos que suportam, nem todos os SGBDs armazenam como metadados 17 O Que é SGBD? Sistema que intermedia todos os acessos ao BD Garante a integridade e a segurança dos dados Facilidades de backup e recuperação de falhas Suporte para processamento multiusuário 18

7 Papéis em um Ambiente de BD Administrador do SGBD Responsável pela instalação e manutenção do SGBD Possui os mais altos privilégios Detém profundos conhecimentos de SO Administrador de Banco de Dados Responsável por criar e manter BDs Possui altos privilégios nos BDs que administra Administrador de Dados Responsável pelo ambiente de dados corporativo Usuários leigos, iniciados, programadores, analistas 19 Arquitetura de um SGBD Programadores analistas Usuàrio Leigo Usuário Iniciado DBA/AD Administrador de SGBD/DBA Ferramenta de composição de formulários Programa de Aplicação, relats, forms Interface de Consulta Ferramenta de manipulação da estrutura Ferramenta de composição de relatórios Ferramenta de compilação de aplicativos SGBD Ferramenta de administração Controle de usuarios, Backup e recuperação, Monitoramento do uso, Configuração do SGBD, etc. DADOS METADADOS 20 Linguagens de Banco de Dados Definição Data Definition Language - DDL Para definição dos tipos de dados a serem tratados em um banco de dados Manipulação Data Manipulation Language - DML Para consultar, atualizar, transformar e excluir dados de um banco de dados 21

8 Componentes de um SGBD Usuários baseado em Garcia-Molina, Ullman, e Widom PROCESSADOR DE CONSULTAS ESTATÍSTICAS COMPILADOR DE CONSULTAS DML Plano de consulta MECANISMO DE EXECUÇÃO Solicitações de dados GERENCIADOR DE RECURSOS GERENCIADOR DE GERENCIADOR DE INDICES ARMAZENAMENTO Ponteiros p/ elementos de dados METADADOS estruturas, formatos, índices, etc. Páginas de dados GERENCIADOR DE BUFFERS INDICES DADOS BUFFERS 22 Componentes de um SGBD PROCESSADOR DE CONSULTAS COMPILADOR DE CONSULTAS DML ANALISADOR Árvore de consulta METADADOS PRÉ-PROCESSADOR Árvore algébrica ESTATÍSTICAS OTIMIZADOR Plano de consulta MECANISMO DE EXECUÇÃO 23 Acesso ao Banco de Dados (6B) (7B) Buffer (9) Código de Retorno (1) Metadados (2) (3) (4) SGBD Programa de Aplicação (7A) (8) (5) Sistema Operacional (6A) Banco de Dados 24

9 Transações Duas ou mais operações de BD que devem ser executadas segundo as propriedades ACID Atomicamente mantendo a Consistência em Isolamento com Durabilidade 25 Componentes de um SGBD PROCESSADOR DE TRANSAÇõES TABELA DE BLOQUEIO COMPILADOR DE CONSULTAS DML Plano de consulta MECANISMO DE EXECUÇÃO DA CONSULTA CONTROLE DE CONCORRÊNCIA REGISTRO DE LOG E RECUPERAÇÃO Solicitações de dados GERENCIADOR DE RECURSOS GERENCIADOR DE INDICES GERENCIADOR DE ARMAZENAMENTO GERENCIADOR DE BUFFERS METADADOS ESTATÍSTICAS INDICES DADOS LOG BUFFERS baseado em Garcia-Molina, Ullman, e Widom 26 Componentes de um SGBD INTERPRETADOR DE CONSULTAS DDL MECANISMO DE EXECUÇÃO DA CONSULTA GERENCIADOR DE RECURSOS METADADOS baseado em Garcia-Molina, Ullman, e Widom 27

10 Arquitetura de 3 níveis Usuários Finais NÍVEL EXTERNO Visão Externa 1... Visão Externa n Mapeamento Conceitual Externo Independência de dados Lógica Física NÍVEL LÓGICO NÍVEL INTERNO Esquema Lógico Esquema Interno Mapeamento Conceitual Interno Banco de Dados Armazenado 28 Modelo de Dados Coleção de conceitos para descrever um conjunto de dados e as operações que os manipulam Conceitos construídos a partir de mecanismos de abstração Conceitos definidos em termos verbais ou gráficos Em geral, possui uma notação gráfica 29 Tipos de Modelos de Dados Modelo Conceitual ferramenta para representação da realidade em um alto-nível de abstração Modelo Lógico ferramenta para descrição de estruturas de dados em uma forma passível de ser processada por computador Modelo Físico conjunto das estruturas de armazenamento e dos métodos de acesso aos dados 30

11 Esquema Representação de uma porção específica da realidade, a partir de um modelo de dados particular Coleção estática de estruturas sintáticas e/ou gráficas que descrevem um certo conjunto de dados Representa uma restrição às possíveis coleções de dados que podem descrever uma dada realidade Pode ter muitas instâncias 31 Instância de Esquema Coleção dinâmica de dados que se conforma à estrutura definida pelo esquema Representa uma restrição às possíveis coleções de dados que podem descrever uma dada realidade Representa o estado do banco de dados num instante particular 32 Modelo, Esquema e Instância percepção da estrutura dos dados existentes na realidade fatos da realidade num instante particular Modelo Esquema Instância regras para validação de instâncias regras para estruturação de dados 33

12 Exemplo CONCEITOS CONCEITOS DO DO MODELO MODELO DE DE DADOS DADOS Campo Campo Registro Registro Pessoa Automóvel ESQUEMA ESQUEMA Nome Sexo Endereço Identidade Placa Marca Modelo Cor O esquema acima descreve uma realidade na qual exitem pessoas e automóveis Os registros Pessoa e Automóvel representam uma abstração sobre dois conjuntos de objetos de uma realidade Posso criar uma instância para o conj de pessoas e automóveis de cada condomínio do RJ 34 Gerência de Dados - Histórico Data Management: Past, Present and Future -- Jim Gray 1a. Geração : processamento manual de dados blocos de argila papiro pergaminho papel 1800: cartões perfurados para fabricar tecidos, tocar música (pianolas) 2a. Geração : : processamento mecânico de dados a partir de cartões perfurados Censo dos Estados Unidos programação pelo painel de controle da máquina Andares inteiros para armazenar cartões e perfuradoras Hollerith: International Business Machines IBM 35 Gerência de Dados - Histórico 3a. Geração : Armazenamento de programas (von Neumman) Fita magnética: economia de espaço Processamento seqüencial de registros Linguagens de alto nível, e.g. COBOL Processamento batch New Data Master file report New Data batch New Master file 36

13 Gerência de Dados - Histórico 4a. Geração : Discos magnéticos Acesso a grupos de registros Processamento online Independência de dados: esquemas lógico e físico Transações para tratar acesso concorrente SGBDs baseados no modelo de rede e hierárquico 37 Gerência de Dados - Histórico 5a. Geração : SGBDs relacionais Linguagens de 4a. Geração Interfaces mais intuitivas Processamento paralelo Aplicações cliente-servidor 38 Gerência de Dados - Histórico 6a. Geração : Novos tipo de dados: imagem, som, video, Busca e recuperação por conteúdo Banco de dados objeto-relacional Banco de dados na internet Banco de dados sobre a internet Dados Semi-estruturados Ferramentas OLAP GED 39

14 Resumindo Mainframes Processamento de de Transações Microcomputadores Aplicações Pessoais Redes de Computadores Aplicações Cliente-Servidor Integração Ampla Bancos de de Dados Distribuídos 40 Arquitetura Cliente/Servidor Usuários Aplicações Clientes (Front-Ends) Middleware SGBD SGBD SGBD Servidores (Back-End) Banco de Dados Banco de Dados Banco de Dados 41 Banco de Dados Distribuídos Plataformas heterogêneas IBM HP DEC Necessidade de Integração Processamento Cooperativo Novos tipos de aplicações e de dados 42

15 58 Evolução dos Modelos e SGBDs Modelo E-R Chen, TOTAL (Rede limitado) 74 IDMS (Rede) IMS (Hierárquico) 82 Pré-SGBDs: Estruturas de acesso suportadas pelo SO 86 OO / OR 90 Protótipos OO DB2 (Relacional) INGRES, ORACLE (Relacionais) 94 Sistema R (Relacional), DATACOM, ADABAS Modelo Relacional Codd, XML (Tamino) SGBDs Universais Ontos, O2, Postgres Adaplex Exodus SDM 43 SGBDs relacionais Dataflex Paradox Progress SQLBase SQL Server Unify Watcom DB2 Oracle Sybase Informix CA-Ingres Zim Mercado nos anos SGBDs Relacionais(-objeto) Hoje Oracle 10g (Grid computing) Oracle 10g Express Edition (http://www.oracle.com/technology/products/database/x e/index.html) IBM DB2 8.2 Microsoft SQL Server 2005 Borland Interbase 7.5 PostgreSQL 8.1 (versão windows) MySQL Oracle compra MySQL engine (http://www.cio.in/news/viewarticle/articleid=490) Firebird (partiu do Interbase 6.0) Firebird 2.0 Second Beta is Released 45

16 Aplicações Típicas Economia Doméstica Livraria Travessa Cadastro ONIP Sistema de Legislação Acadêmica Projeto BIOWebDB 46 Economia Doméstica Despesas domésticas cada vez mais diversificadas e de difícil gerência Dificuldade de visualizar quando investir Bancos com muitas opções de investimento Dificuldade em prever gastos Poucos usuários: tamanho da família 47 Economia Doméstica Facilitar a entrada de dados Gastos extras (não previstos) Faturas dos cartões (parcelamentos) Gastos informais (com dinheiro vivo) Interface com Bancos Volume de dados pequeno Cerca de 30 entradas por mês ou 360 por ano Menos de 1 Giga em 10 anos 48

17 Economia Doméstica Possíveis consultas: Que itens têm pesado no orçamento? Quando poderia assumir gastos mais pesados? (Fazer uma obra de melhoria) Que investimentos fazer no momento? 49 Livraria Travessa Empresa de médio porte que comercializa livros e cds Muitos fornecedores (editoras), com especialidades diversas, diferentes formas de negociação, tempo de entrega, etc. Precisa registrar as compras e vendas ocorridas, controlando o estoque Dificuldades em encontrar a mercadoria na loja Necessidade compartilhar informação entre os PDV. 50 Livraria Travessa Em torno de 50 usuários Vendedores (35) Gerentes (5) Clientes (10) 51

18 Livraria Travessa Arquitetura cliente-servidor Gerência de replicação de dados Gerência de transações Processamento batch (para atualização do servidor) SERVIDOR Plataforma Intranet com vistas a disponibizar na Internet PDVs 52 Livraria Travessa Interface de consulta inteligente e busca eficiente Busca por um dado livro, por autor, título, editora e/ou palavra-chave Busca por editoras e suas características Relat mensal de vendas e as vendas realizadas por cada vendedor Relat mensal de compras de fornecedores 53 Cadastro ONIP Organização Nacional da Indústria do Petróleo: ONG de pequeno porte Credenciamento de empresas do setor de Petróleo Divulgação de notícias e artigos relevantes sobre o setor Monitoramento da cadeia de suprimentos do setor Promoção da nacionalização de materiais e serviços 54

19 Cadastro ONIP Previsão aproximada de usuários Empresas certificadas (2000) Empresas clientes (8000) Gerentes ONG (10) Empresas certificadoras (50) Economistas especialistas (20) 55 Cadastro ONIP Plataforma Internet: para permitir acesso das empresas associadas Consulta ao cadastro Atualização anual do cadastro Alimentação do conteúdo informativo Disponibilizar ferramenta de busca por conteúdo Manter registros dos contratos das empresas (contratadas e contratantes) Manter descrição dos materiais e serviços do setor, discriminando componentes quando for o caso 56 Cadastro ONIP Relatórios sobre status das empresas em credenciamento pendente, em análise, candidata, credenciada, expirada Permitir análises gerenciais do setor Acompanhamento do faturamento das empresas Identificação de Falhas na cadeia de suprimentos Estabelecimento de índices de nacionalização Estatísticas diversas 57

20 Sistema SILA Sistema de Legislação Acadêmica Comunidade acadêmica precisa conhecer as regras que a regem Evasão de alunos Agilização de processos Gestão de cursos stricto e lato sensu Dificuldade de acompanhamento da legislação vigente Diversos tipos de atos a acompanhar: Leis, decretos, resoluções, etc. Diversas fontes a consultar Interdependência entre atos 58 Sistema SILA Aproximandamente usuários Professores (5000) Alunos (30000) Funcionários (5000) 59 Sistema SILA Foco na consulta Plataforma Internet: comunidade ampla de usuários Atualização periódica e centralizada Interface com órgãos superiores para carga semi-automática e periódica do cadastro de atos Dados tipicamente semi-estruturados 60

21 Projeto BioWebDB Consórcio para o desenvolvimento de aplicações em bioinformática para sequenciamento de genomas Programas dispersos, rodando em plataformas diferenciadas Dados volumosos Necessidade de encadeamento dos programas Necessidade de registro de utilização de dados e programas Projetos de pesquisa, tendência à utilização de plataformas open source 61 Projeto BioWebDB Aproximadamente 1000 usuários Biólogos Bioinformatas Informatas Comunidade interdisciplinar 62 Projeto BioWebDB Plataforma Internet Serviços Web: Integração de programas em múltiplas plataformas Controle de usuários/projeto Esquema de dados abrangente para abrigar resultados de diversos programas Interface para composição de programas (definição de workflows) Notificação de anotação de sequências Filtros para seleção e conversão de resultados 63

22 Comparação Aplicativos Arquitetura Qtde de Usuários Modelo de Dados Lógico Economia Doméstica Monousuário < 10 Relacional Travessa SILA ONIP BioWebDB Cliente/ servidor Cliente/ servidor Intranet Cliente/ servidor Internet Cliente/ Servidor Internet (middleware) Dezenas Milhares Milhares Milhares Relacional XML Nativo Relacional XML enabled Relacional XML enabled 64

Introdução a Banco de Dados Instituto Militar de Engenharia - IME Tópicos Conceitos básicos Arquitetura Modelo/Esquema Histórico Tendências 2 Definições DADOS x INFORMAÇÃO x CONHECIMENTO Dados: conjunto

Leia mais

Banco de Dados I Ementa:

Banco de Dados I Ementa: Banco de Dados I Ementa: Banco de Dados Sistema Gerenciador de Banco de Dados Usuários de um Banco de Dados Etapas de Modelagem, Projeto e Implementação de BD O Administrador de Dados e o Administrador

Leia mais

Dado: Fatos conhecidos que podem ser registrados e têm um significado implícito. Banco de Dados:

Dado: Fatos conhecidos que podem ser registrados e têm um significado implícito. Banco de Dados: MC536 Introdução Sumário Conceitos preliminares Funcionalidades Características principais Usuários Vantagens do uso de BDs Tendências mais recentes em SGBDs Algumas desvantagens Modelos de dados Classificação

Leia mais

Prof.: Clayton Maciel Costa clayton.maciel@ifrn.edu.br

Prof.: Clayton Maciel Costa clayton.maciel@ifrn.edu.br Programação com acesso a BD Prof.: Clayton Maciel Costa clayton.maciel@ifrn.edu.br 1 Modelos de Dados, Esquemas e Instâncias 2 Modelos de Dados, Esquemas e Instâncias Modelo de dados: Conjunto de conceitos

Leia mais

Banco de Dados I. Introdução. Fabricio Breve

Banco de Dados I. Introdução. Fabricio Breve Banco de Dados I Introdução Fabricio Breve Introdução SGBD (Sistema Gerenciador de Banco de Dados): coleção de dados interrelacionados e um conjunto de programas para acessar esses dados Coleção de dados

Leia mais

Introdução a Computação

Introdução a Computação Introdução a Computação Aula 04 SGBD Sistemas Gerenciadores de Bancos de Dados Prof. MSc. Edilberto Silva edilms@yahoo.com Conceitos Básicos DADOS: são fatos em sua forma primária. Ex: nome do funcionário,

Leia mais

Sistemas Gerenciadores de Bancos de Dados

Sistemas Gerenciadores de Bancos de Dados Sistemas Gerenciadores de Bancos de Dados Fernando Castor A partir de slides elaborados por Fernando Fonseca & Robson Fidalgo 1 Sistemas de Arquivos Sistemas de arquivos Principal característica é a replicação

Leia mais

INTRODUÇÃO E CONCEITOS BÁSICOS. Prof. Ronaldo R. Goldschmidt

INTRODUÇÃO E CONCEITOS BÁSICOS. Prof. Ronaldo R. Goldschmidt INTRODUÇÃO E CONCEITOS BÁSICOS Prof. Ronaldo R. Goldschmidt Hierarquia Dado - Informação - Conhecimento: Dados são fatos com significado implícito. Podem ser armazenados. Dados Processamento Informação

Leia mais

INF220 - Banco de Dados I

INF220 - Banco de Dados I Banco de Dados - Introdução Bibliografia INF220 - Banco de Dados I Prof. Jugurta Lisboa Filho Departamento de Informática - UFV Notas de Aula (jugurta@dpi.ufv.br) ELMASRI, R; NAVATHE, S. Fundamentals of

Leia mais

Banco de Dados Capítulo 1: Introdução. Especialização em Informática DEINF/UFMA Cláudio Baptista

Banco de Dados Capítulo 1: Introdução. Especialização em Informática DEINF/UFMA Cláudio Baptista Banco de Dados Capítulo 1: Introdução Especialização em Informática DEINF/UFMA Cláudio Baptista O que é um Banco de Dados (BD)? É uma coleção de dados relacionados e armazenados em algum dispositivo. Propriedades

Leia mais

Conceitos Básicos. Conceitos Básicos. Sistema de Arquivos. Prof. Edilberto Silva - edilms@yahoo.com. Sistemas de Informação Brasília/DF

Conceitos Básicos. Conceitos Básicos. Sistema de Arquivos. Prof. Edilberto Silva - edilms@yahoo.com. Sistemas de Informação Brasília/DF 2 Conceitos Básicos Material baseado nas notas de aula: Maria Luiza M. Campos IME/2005 Carlos Heuser - livro Projeto de Banco de Dados CasaNova / PUC/RJ Prof. MSc. Edilberto Silva edilms@yahoo.com Sistemas

Leia mais

Laboratório de Banco de Dados

Laboratório de Banco de Dados Universidade Federal de Mato Grosso-UFMT Sistemas de Informação Laboratório de Banco de Dados Prof. Clóvis Júnior Laboratório de Banco de Dados Conteúdo Administração de Usuários de Papéis; Linguagens

Leia mais

Prof. Marcelo Machado Cunha www.marcelomachado.com mcelobr@yahoo.com.br

Prof. Marcelo Machado Cunha www.marcelomachado.com mcelobr@yahoo.com.br Prof. Marcelo Machado Cunha www.marcelomachado.com mcelobr@yahoo.com.br Ementa Introdução a Banco de Dados (Conceito, propriedades), Arquivos de dados x Bancos de dados, Profissionais de Banco de dados,

Leia mais

Etapas da evolução rumo a tomada de decisão: Aplicações Isoladas: dados duplicados, dados inconsistentes, processos duplicados.

Etapas da evolução rumo a tomada de decisão: Aplicações Isoladas: dados duplicados, dados inconsistentes, processos duplicados. Histórico Etapas da evolução rumo a tomada de decisão: Aplicações Isoladas: dados duplicados, dados inconsistentes, processos duplicados. Sistemas Integrados: racionalização de processos, manutenção dos

Leia mais

Banco de Dados. Uma coleção de dados relacionados [ELMASRI/NAVATHE]

Banco de Dados. Uma coleção de dados relacionados [ELMASRI/NAVATHE] 1/6 Banco de Dados O que é um Banco de Dados? Uma coleção de dados relacionados [ELMASRI/NAVATHE] Conjunto de dados integrados que tem por objetivo atender a uma comunidade específica [HEUSER] Um conjunto

Leia mais

Introdução à Banco de Dados. Definição

Introdução à Banco de Dados. Definição Universidade Federal da Bahia Departamento de Ciência da Computação (DCC) Disciplina: Banco de Dados Profª. Daniela Barreiro Claro Introdução à Banco de Dados Definição Um banco de dados é uma coleção

Leia mais

SISTEMA GERENCIADOR DE BANCO DE DADOS

SISTEMA GERENCIADOR DE BANCO DE DADOS BANCO DE DADOS Universidade do Estado de Santa Catarina Centro de Ciências Tecnológicas Departamento de Ciência da Computação Prof. Alexandre Veloso de Matos alexandre.matos@udesc.br SISTEMA GERENCIADOR

Leia mais

20/05/2013. Sistemas de Arquivos Sistemas de arquivos. Sistemas de Gerenciamento de Banco de Dados (SGBD) Banco de Dados. Estrutura de um BD SGBD

20/05/2013. Sistemas de Arquivos Sistemas de arquivos. Sistemas de Gerenciamento de Banco de Dados (SGBD) Banco de Dados. Estrutura de um BD SGBD Gerenciamento de Dados e Informação Fernando Fonseca Ana Carolina Robson Fidalgo Sistemas de Arquivos Sistemas de arquivos Principal característica é a replicação e isolamento de dados (ilhas de informações)

Leia mais

Banco de Dados 1 Prof. MSc Wagner Siqueira Cavalcante

Banco de Dados 1 Prof. MSc Wagner Siqueira Cavalcante Banco de Dados 1 Programação sucinta do curso:. Conceitos fundamentais de Banco de Dados.. Arquitetura dos Sistemas Gerenciadores de Banco de Dados (SGBD ou DBMS).. Características típicas de um SGBD..

Leia mais

Sistemas Gerenciadores de Bancos de Dados

Sistemas Gerenciadores de Bancos de Dados Sistemas Gerenciadores de Bancos de Dados Orivaldo V. Santana Jr A partir de slides elaborados por Ivan G. Costa Filho Fernando Fonseca & Robson Fidalgo 1 Sistemas de Arquivos Sistemas de arquivos Principal

Leia mais

Introdução. Motivação. Sistema Gerenciador de Banco de Dados (SGBD) Banco de Dados (BD) Sistema de Banco de Dados (SBD)

Introdução. Motivação. Sistema Gerenciador de Banco de Dados (SGBD) Banco de Dados (BD) Sistema de Banco de Dados (SBD) Pós-graduação em Ciência da Computação CCM-202 Sistemas de Banco de Dados Introdução Profa. Maria Camila Nardini Barioni camila.barioni@ufabc.edu.br Bloco B - sala 937 2 quadrimestre de 2011 Motivação

Leia mais

Fundamentos de Banco de Dados

Fundamentos de Banco de Dados Fundamentos de Banco de Dados SISTEMAS BASEADOS NO PROCESSAMENTO DE ARQUIVOS Sistema A Funcionário Pagamento Cargo Sistema B Funcionário Projeto SISTEMAS GERENCIADORES DE BANCO DE DADOS (SGBD) Sistema

Leia mais

SISTEMAS DE BANCO DE DADOS. Prof. Adriano Pereira Maranhão

SISTEMAS DE BANCO DE DADOS. Prof. Adriano Pereira Maranhão SISTEMAS DE BANCO DE DADOS Prof. Adriano Pereira Maranhão 1 REVISÃO BANCO DE DADOS I O que é banco de dados? Ou seja afinal o que é um SGBD? REVISÃO BD I REVISÃO DE BD I Um Sistema de Gerenciamento de

Leia mais

Introdução Banco de Dados

Introdução Banco de Dados Introdução Banco de Dados Vitor Valerio de Souza Campos Adaptado de Vania Bogorny Por que estudar BD? Os Bancos de Dados fazem parte do nosso dia-a-dia: operação bancária reserva de hotel matrícula em

Leia mais

Banco de Dados I 2007. Módulo I: Introdução a Sistemas de Banco de Dados. (Aula 1) Clodis Boscarioli

Banco de Dados I 2007. Módulo I: Introdução a Sistemas de Banco de Dados. (Aula 1) Clodis Boscarioli Banco de Dados I 2007 Módulo I: Introdução a Sistemas de Banco de Dados (Aula 1) Clodis Boscarioli Agenda: Apresentação do Plano de Ensino; Aspectos Históricos; Estrutura Geral de um SGBD; Profissionais

Leia mais

Banco de Dados. Conceitos e Arquitetura de Sistemas de Banco de Dados. Profa. Flávia Cristina Bernardini

Banco de Dados. Conceitos e Arquitetura de Sistemas de Banco de Dados. Profa. Flávia Cristina Bernardini Banco de Dados Conceitos e Arquitetura de Sistemas de Banco de Dados Profa. Flávia Cristina Bernardini Relembrando... Vantagens da Utilização de SGBD Redundância controlada Consistência dos dados armazenados

Leia mais

Introdução a Informática. Prof.: Roberto Franciscatto

Introdução a Informática. Prof.: Roberto Franciscatto Introdução a Informática Prof.: Roberto Franciscatto 6.1 ARQUIVOS E REGISTROS De um modo geral os dados estão organizados em arquivos. Define-se arquivo como um conjunto de informações referentes aos elementos

Leia mais

Roteiro 2 Conceitos Gerais

Roteiro 2 Conceitos Gerais Roteiro 2 Conceitos Gerais Objetivos: UC Projeto de Banco de Dados Explorar conceitos gerais de bancos de dados; o Arquitetura de bancos de dados: esquemas, categorias de modelos de dados, linguagens e

Leia mais

Introdução a Sistemas de Bancos de Dados

Introdução a Sistemas de Bancos de Dados Introdução a Sistemas de Bancos de Dados Prof. UFES - Universidade Federal do Espírito Santo rapchan@inf.ufes.br http://www.inf.ufes.br/~rapchan Roteiro da Apresentação Introdução Características de um

Leia mais

GBD. Introdução PROF. ANDREZA S. AREÃO

GBD. Introdução PROF. ANDREZA S. AREÃO GBD Introdução PROF. ANDREZA S. AREÃO Sistema de arquivos X Sistemas de Banco de Dados Sistema de arquivos Sistema de Banco de Dados Aplicativos Dados (arquivos) Aplicativos SGBD Dados (arquivos) O acesso/gerenciamento

Leia mais

Evolução. Tópicos. Bancos de Dados - Introdução. Melissa Lemos. Evolução dos Sistemas de Informação Esquemas Modelos. Características de SGBDs

Evolução. Tópicos. Bancos de Dados - Introdução. Melissa Lemos. Evolução dos Sistemas de Informação Esquemas Modelos. Características de SGBDs 1 Bancos de Dados - Introdução Melissa Lemos melissa@inf.puc-rio.br Tópicos Evolução dos Sistemas de Informação Esquemas Modelos Conceitual Lógico Características de SGBDs 2 Evolução tempo Programas e

Leia mais

CONCEITOS BÁSICOS. 1. Conceitos básicos de BD, SBD e SGBD BANCO DE DADOS I

CONCEITOS BÁSICOS. 1. Conceitos básicos de BD, SBD e SGBD BANCO DE DADOS I CONCEITOS BÁSICOS 1. Conceitos básicos de BD, SBD e SGBD A importância da informação para a tomada de decisões nas organizações tem impulsionado o desenvolvimento dos sistemas de processamento de informações.

Leia mais

Introdução. Conceitos Básicos. Conceitos Básicos. Conceitos Básicos

Introdução. Conceitos Básicos. Conceitos Básicos. Conceitos Básicos Conceitos Básicos Introdução Banco de Dados I Prof. Guilherme Tavares de Assis Universidade Federal de Ouro Preto UFOP Instituto de Ciências Exatas e Biológicas ICEB Departamento de Computação DECOM Dados

Leia mais

Para construção dos modelos físicos, será estudado o modelo Relacional como originalmente proposto por Codd.

Para construção dos modelos físicos, será estudado o modelo Relacional como originalmente proposto por Codd. Apresentação Este curso tem como objetivo, oferecer uma noção geral sobre a construção de sistemas de banco de dados. Para isto, é necessário estudar modelos para a construção de projetos lógicos de bancos

Leia mais

GBC043 Sistemas de Banco de Dados. Introdução. Ilmério Reis da Silva ilmerio@facom.ufu.br www.facom.ufu.br/~ilmerio/sbd UFU/FACOM

GBC043 Sistemas de Banco de Dados. Introdução. Ilmério Reis da Silva ilmerio@facom.ufu.br www.facom.ufu.br/~ilmerio/sbd UFU/FACOM GBC043 Sistemas de Banco de Dados Introdução Ilmério Reis da Silva ilmerio@facom.ufu.br www.facom.ufu.br/~ilmerio/sbd UFU/FACOM Página 2 Definição BD Def. Banco de Dados é uma coleção de itens de dados

Leia mais

Disciplina: Tecnologias de Banco de Dados para SI s

Disciplina: Tecnologias de Banco de Dados para SI s Curso de Gestão em SI Disciplina: Tecnologias de Banco de Dados para SI s Rodrigo da Silva Gomes (Extraído do material do prof. Ronaldo Melo - UFSC) Banco de Dados (BD) BD fazem parte do nosso dia-a-dia!

Leia mais

Banco de Dados. Professor: Rômulo César. romulodandrade@gmail.com www.romulocesar.com.br

Banco de Dados. Professor: Rômulo César. romulodandrade@gmail.com www.romulocesar.com.br Banco de Dados Professor: Rômulo César romulodandrade@gmail.com www.romulocesar.com.br Sistema de arquivos X Sistemas de Banco de Dados Sistema de arquivos Sistema de Banco de Dados Aplicativos Dados (arquivos)

Leia mais

Banco de Dados. Aula Inaugural. CURSO: CC/SI SÉRIE: 2º e 3º semestre DISCIPLINA: Banco de Dados CARGA HORÁRIA SEMANAL: 04 horasaula

Banco de Dados. Aula Inaugural. CURSO: CC/SI SÉRIE: 2º e 3º semestre DISCIPLINA: Banco de Dados CARGA HORÁRIA SEMANAL: 04 horasaula Banco de Dados Aula Inaugural CURSO: CC/SI SÉRIE: 2º e 3º semestre DISCIPLINA: Banco de Dados CARGA HORÁRIA SEMANAL: 04 horasaula CARGA HORÁRIA SEMESTRAL: 80 horas-aula Semana 1: Semana 2: 4 aulas de teoria

Leia mais

Capítulo I -Introdução a Banco de Dados

Capítulo I -Introdução a Banco de Dados Capítulo I -Introdução a Banco de Dados Emerson Cordeiro Morais ( emersoncm@estacio.br) Doutorando em Bioinformática Mestre em Banco de Dados Agenda Dados, Banco de Dados e SGBD Evolução Histórica dos

Leia mais

Introdução. Banco de dados. Por que usar BD? Por que estudar BD? Exemplo de um BD. Conceitos básicos

Introdução. Banco de dados. Por que usar BD? Por que estudar BD? Exemplo de um BD. Conceitos básicos Introdução Banco de Dados Por que usar BD? Vitor Valerio de Souza Campos Adaptado de Vania Bogorny 4 Por que estudar BD? Exemplo de um BD Os Bancos de Dados fazem parte do nosso dia-a-dia: operação bancária

Leia mais

BANCO DE DADOS E BUSINESS INTELIGENCE. C/H: 20 horas (20/02, 25/02, 27/02, 04/03, 06/03)

BANCO DE DADOS E BUSINESS INTELIGENCE. C/H: 20 horas (20/02, 25/02, 27/02, 04/03, 06/03) MBA em Gestão de TI MÓDULO: BANCO DE DADOS E BUSINESS INTELIGENCE C/H: 20 horas (20/02, 25/02, 27/02, 04/03, 06/03) PROFESSOR: Edison Andrade Martins Morais prof@edison.eti.br http://www.edison.eti.br

Leia mais

Introdução. Gerenciamento de Dados e Informação. Principais Tipos de SI. Papel de SI. Principais Tipos de SI. Principais Tipos de SI.

Introdução. Gerenciamento de Dados e Informação. Principais Tipos de SI. Papel de SI. Principais Tipos de SI. Principais Tipos de SI. Introdução Gerenciamento de Dados e Informação Introdução Sistema de Informação (SI) Coleção de atividades que regulam o compartilhamento e a distribuição de informações e o armazenamento de dados relevantes

Leia mais

Fundamentos dos Sistemas de Informação Organização de Dados e Informações

Fundamentos dos Sistemas de Informação Organização de Dados e Informações Fundamentos dos Sistemas de Informação Organização de Dados e Informações http://professor.fimes.edu.br/milena milenaresende@fimes.edu.br Sistema de Gerenciamento de Bases de Dados (DBMS) A implementação

Leia mais

Programação com acesso a BD. Prof.: Clayton Maciel Costa clayton.maciel@ifrn.edu.br

Programação com acesso a BD. Prof.: Clayton Maciel Costa clayton.maciel@ifrn.edu.br Programação com acesso a BD Prof.: Clayton Maciel Costa clayton.maciel@ifrn.edu.br 1 Introdução BD desempenha papel crítico em todas as áreas em que computadores são utilizados: Banco: Depositar ou retirar

Leia mais

Prof.: Clayton Maciel Costa clayton.maciel@ifrn.edu.br

Prof.: Clayton Maciel Costa clayton.maciel@ifrn.edu.br Programação com acesso a BD Prof.: Clayton Maciel Costa clayton.maciel@ifrn.edu.br 1 Agenda Introdução Conceitos do Modelo Relacional Restrições de Integridade Básicas Esquema do BD Relacional Restrições

Leia mais

Hoje é inegável que a sobrevivência das organizações depende de dados precisos e atualizados.

Hoje é inegável que a sobrevivência das organizações depende de dados precisos e atualizados. BANCO DE DADOS Universidade do Estado de Santa Catarina Centro de Ciências Tecnológicas Departamento de Ciência da Computação Prof. Alexandre Veloso de Matos alexandre.matos@udesc.br INTRODUÇÃO Hoje é

Leia mais

1. CONCEITOS BÁSICOS DE BD, SBD E SGBD

1. CONCEITOS BÁSICOS DE BD, SBD E SGBD Introdução 1. CONCEITOS BÁSICOS DE BD, SBD E SGBD A importância da informação para a tomada de decisões nas organizações tem impulsionado o desenvolvimento dos sistemas de processamento de informações.

Leia mais

BANCO DE DADOS CONCEITOS BÁSICOS

BANCO DE DADOS CONCEITOS BÁSICOS Universidade Federal da Paraíba UFPB Centro de Energias Alternativas e Renováveis - CEAR Departamento de Eng. Elétrica DEE BANCO DE DADOS CONCEITOS BÁSICOS Isaac Maia Pessoa Introdução O que é um BD? Operações

Leia mais

FACULDADE INTEGRADAS DE PARANAÍBA ADMINISTRAÇÃO DE EMPRESAS. Bancos de Dados Conceitos Fundamentais

FACULDADE INTEGRADAS DE PARANAÍBA ADMINISTRAÇÃO DE EMPRESAS. Bancos de Dados Conceitos Fundamentais FACULDADE INTEGRADAS DE PARANAÍBA ADMINISTRAÇÃO DE EMPRESAS Bancos de Dados Conceitos Fundamentais Tópicos Conceitos Básicos Bancos de Dados Sistemas de Bancos de Dados Sistemas de Gerenciamento de Bancos

Leia mais

Introdução. Unidade 1. Engenharia de Computação / Engenharia de Produção Banco de Dados Prof. Maria das Graças da Silva Teixeira

Introdução. Unidade 1. Engenharia de Computação / Engenharia de Produção Banco de Dados Prof. Maria das Graças da Silva Teixeira Unidade 1 Introdução Engenharia de Computação / Engenharia de Produção Banco de Dados Prof. Maria das Graças da Silva Teixeira Material base: Banco de Dados, 2009.2, prof. Otacílio José Pereira Contexto

Leia mais

Universidade Federal de Santa Maria Curso de Arquivologia. Disciplina de Banco de Dados Aplicados à Arquivística. Versao 1.

Universidade Federal de Santa Maria Curso de Arquivologia. Disciplina de Banco de Dados Aplicados à Arquivística. Versao 1. Universidade Federal de Santa Maria Curso de Arquivologia Disciplina de Banco de Dados Aplicados à Arquivística Prof. Andre Zanki Cordenonsi Versao 1.0 Março de 2008 Tópicos Abordados Conceitos sobre Banco

Leia mais

Arquitetura de Banco de Dados

Arquitetura de Banco de Dados Arquitetura de Banco de Dados Daniela Barreiro Claro MAT A60 DCC/IM/UFBA Arquitetura de Banco de dados Final de 1972, ANSI/X3/SPARC estabeleceram o relatório final do STUDY GROUP Objetivos do Study Group

Leia mais

Roteiro. Conceitos e Arquitetura de Sistemas de Banco de Dados. Conceitos e Arquiteturas de Sistemas de Banco de Dados. BCC321 - Banco de Dados I

Roteiro. Conceitos e Arquitetura de Sistemas de Banco de Dados. Conceitos e Arquiteturas de Sistemas de Banco de Dados. BCC321 - Banco de Dados I Roteiro Conceitos e Arquitetura de Sistemas de Banco de Dados Luiz Henrique de Campos Merschmann Departamento de Computação Universidade Federal de Ouro Preto luizhenrique@iceb.ufop.br www.decom.ufop.br/luiz

Leia mais

Banco de Dados. Tópicos. CIn/UFPE. Conceitos Básicos

Banco de Dados. Tópicos. CIn/UFPE. Conceitos Básicos Banco de Dados CIn/UFPE Ana Carolina Salgado Fernando Fonseca Valéria Times Conceitos Básicos Modelagem Conceitual Modelo Relacional Mapeamento ER/Relacional SQL / Aplicações Modelos Orientados a Objetos

Leia mais

SQL APOSTILA INTRODUÇÃO A LINGUAGEM SQL

SQL APOSTILA INTRODUÇÃO A LINGUAGEM SQL SQL APOSTILA INTRODUÇÃO Uma linguagem de consulta é a linguagem por meio da qual os usuários obtêm informações do banco de dados. Essas linguagens são, tipicamente, de nível mais alto que as linguagens

Leia mais

Persistência e Banco de Dados em Jogos Digitais

Persistência e Banco de Dados em Jogos Digitais Persistência e Banco de Dados em Jogos Digitais Prof. Marcos Francisco Pereira da Silva Especialista em Engenharia de Software Jogos Digitais - Computação Gráfica 1 Agenda Vantagens de usar a abordagem

Leia mais

PROJETO DE BANCO DE DADOS -INTRODUÇÃO. Prof. Angelo Augusto Frozza, M.Sc.

PROJETO DE BANCO DE DADOS -INTRODUÇÃO. Prof. Angelo Augusto Frozza, M.Sc. 1 PROJETO DE BANCO DE DADOS -INTRODUÇÃO Prof. Angelo Augusto Frozza, M.Sc. FUNDAMENTOS Dados Representação de fatos, conceitos ou instruções de maneira formalizada; Informação Significado que pessoas associam

Leia mais

Introdução a Banco de Dados. Aécio Costa

Introdução a Banco de Dados. Aécio Costa Introdução a Banco de Dados Aécio Costa Porque utilizamos BD? Banco de Dados Um banco de dados é uma coleção de dados persistentes, usada pelos sistemas de aplicação de uma determinada empresa. DATE (2003)

Leia mais

Introdução a Banco de Dados

Introdução a Banco de Dados Introdução a Banco de Dados O modelo relacional Marta Mattoso Sumário Introdução Motivação Serviços de um SGBD O Modelo Relacional As aplicações não convencionais O Modelo Orientado a Objetos Considerações

Leia mais

Sistemas de Banco de Dados Aspectos Gerais de Banco de Dados

Sistemas de Banco de Dados Aspectos Gerais de Banco de Dados Sistemas de Banco de Dados Aspectos Gerais de Banco de Dados 1. Conceitos Básicos No contexto de sistemas de banco de dados as palavras dado e informação possuem o mesmo significado, representando uma

Leia mais

Docente: Éberton da Silva Marinho e-mail: ebertonsm@gmail.com

Docente: Éberton da Silva Marinho e-mail: ebertonsm@gmail.com INSTITUTO FEDERAL DE EDUCAÇÃO, CIÊNCIA E TECNOLOGIA DO RIO GRANDE DO NORTE Introdução a Banco de Dados Docente: Éberton da Silva Marinho e-mail: ebertonsm@gmail.com 12/06/2013 Sumário Motivação da Disciplina

Leia mais

CMP 151 Modelos Avançados CMP 151. ados de Banco de Dados. Renata de Matos Galante Mirella Moura Moro CMP 151. CMP 151 Modelos Avançados de BD

CMP 151 Modelos Avançados CMP 151. ados de Banco de Dados. Renata de Matos Galante Mirella Moura Moro CMP 151. CMP 151 Modelos Avançados de BD CMP 151 CMP 151 Modelos Avançados ados de Banco de Dados Renata de Matos Galante Mirella Moura Moro CMP 151 Modelos Avançados de BD Terças e Quintas 10:30 até 12:10 Sala 102 prédio 43.425 www.inf.ufrgs.br/~galante

Leia mais

SISTEMAS GERENCIADORES DE BANCO DE DADOS 1

SISTEMAS GERENCIADORES DE BANCO DE DADOS 1 SISTEMAS GERENCIADORES DE BANCO DE DADOS 1 AULA 01 1. Qual das seguintes linguagens deu origem à atual SQL (Strututured Query Language)? a) COBOL b) FORTRAN c) SEQUEL d) C e) C++ 2. Sistema Gerenciador

Leia mais

BANCO DE DADOS. Introdução a Banco de Dados. Conceitos BásicosB. Engenharia da Computação UNIVASF. Aula 1. Breve Histórico

BANCO DE DADOS. Introdução a Banco de Dados. Conceitos BásicosB. Engenharia da Computação UNIVASF. Aula 1. Breve Histórico Banco de Dados // 1 Banco de Dados // 2 Conceitos BásicosB Engenharia da Computação UNIVASF BANCO DE DADOS Aula 1 Introdução a Banco de Dados Campo representação informatizada de um dado real / menor unidade

Leia mais

Curso Superior de Tecnologia em BD Curso Superior de Tecnologia em DAI

Curso Superior de Tecnologia em BD Curso Superior de Tecnologia em DAI Curso Superior de Tecnologia em BD Curso Superior de Tecnologia em DAI Fundamentos de Banco de Dados Aula 01 Introdução aos Sistemas de Bancos de Dados Introdução aos Sistemas de BD Objetivo Apresentar

Leia mais

Sistema de Bancos de Dados. Conceitos Gerais Sistema Gerenciador de Bancos de Dados

Sistema de Bancos de Dados. Conceitos Gerais Sistema Gerenciador de Bancos de Dados Sistema de Bancos de Dados Conceitos Gerais Sistema Gerenciador de Bancos de Dados # Definições # Motivação # Arquitetura Típica # Vantagens # Desvantagens # Evolução # Classes de Usuários 1 Nível 1 Dados

Leia mais

Administração de Banco de Dados

Administração de Banco de Dados Administração de Banco de Dados Professora conteudista: Cida Atum Sumário Administração de Banco de Dados Unidade I 1 INTRODUÇÃO A BANCO DE DADOS...1 1.1 Histórico...1 1.2 Definições...2 1.3 Importância

Leia mais

Bancos de Dados. Conceitos F undamentais em S is temas de B ancos de Dados e s uas Aplicações

Bancos de Dados. Conceitos F undamentais em S is temas de B ancos de Dados e s uas Aplicações Conceitos F undamentais em S is temas de B ancos de Dados e s uas Aplicações Tópicos Conceitos Básicos Bancos de Dados Sistemas de Bancos de Dados Sistemas de Gerenciamento de Bancos de Dados Abstração

Leia mais

Conceitos básicos de Banco de Dados

Conceitos básicos de Banco de Dados Modelagem de Banco de Dados Conceitos básicos de Banco de Dados Professor: Anderson D. Moura Março, 2009 Banco de Dados Bancos de dados, (ou bases de dados), são conjuntos de dados com uma estrutura regular

Leia mais

Structured Query Language (SQL) Ambiente Simplificado de um SGBD

Structured Query Language (SQL) Ambiente Simplificado de um SGBD Structured Query Language (SQL) Ambiente Simplificado de um SGBD 2 1 Características dos SGBDs Natureza auto-contida de um sistema de banco de dados: metadados armazenados num catálogo ou dicionário de

Leia mais

Bancos de Dados Aula #1 - Introdução

Bancos de Dados Aula #1 - Introdução Bancos de Dados Aula #1 - Introdução Prof. Eduardo R. Hruschka * Slides baseados no material elaborado pelas professoras: Cristina D. A. Ciferri Elaine P. M. de Souza Motivação Operações bancárias; Compras

Leia mais

Introdução a Banco de Dados. Adão de Melo Neto

Introdução a Banco de Dados. Adão de Melo Neto Introdução a Banco de Dados Adão de Melo Neto 1 Por que estudar BD? Os Bancos de Dados fazem parte do nosso dia-a-dia: operação bancária reserva de hotel matrícula em uma disciplina da universidade cadastro

Leia mais

PROJETO DE BANCO DE DADOS -INTRODUÇÃO. Prof. Angelo Augusto Frozza, M.Sc. http://about.me/tilfrozza

PROJETO DE BANCO DE DADOS -INTRODUÇÃO. Prof. Angelo Augusto Frozza, M.Sc. http://about.me/tilfrozza 1 PROJETO DE BANCO DE DADOS -INTRODUÇÃO Prof. Angelo Augusto Frozza, M.Sc. http://about.me/tilfrozza FUNDAMENTOS Dados Representação de fatos, conceitos ou instruções de maneira formalizada; Informação

Leia mais

Bases de Dados. O que é uma Base de Dados? Pós-Grduação em SIG

Bases de Dados. O que é uma Base de Dados? Pós-Grduação em SIG Bases de Dados O que é uma Base de Dados? Dados Pode-se começar por tentar dar uma definição do que são Dados. Os dados são factos em bruto, que não são necessáriamente relevantes para qualquer coisa que

Leia mais

Banco de Dados. Introdução. João Eduardo Ferreira Osvaldo Kotaro Takai. jef@ime.usp.br DCC-IME-USP

Banco de Dados. Introdução. João Eduardo Ferreira Osvaldo Kotaro Takai. jef@ime.usp.br DCC-IME-USP Banco de Dados Introdução João Eduardo Ferreira Osvaldo Kotaro Takai jef@ime.usp.br DCC-IME-USP Importância dos Bancos de Dados A competitividade das empresas depende de dados precisos e atualizados. Conforme

Leia mais

Prof. Omero, pág. 63. Banco de Dados InterBase.

Prof. Omero, pág. 63. Banco de Dados InterBase. Prof. Omero, pág. 63 O que é o InterBase? O InterBase é um SGBDR - Sistema Gerenciador de Banco de Dados Cliente/Servidor Relacional 1 que está baseado no padrão SQL ANSI-9, de alta performance, independente

Leia mais

Banco de Dados I Introdução

Banco de Dados I Introdução Banco de Dados I Introdução Prof. Moser Fagundes Curso Técnico em Informática (Modalidade Integrada) IFSul Campus Charqueadas Sumário da aula Avaliações Visão geral da disciplina Introdução Histórico Porque

Leia mais

Banco de Dados I. Introdução Conceitos

Banco de Dados I. Introdução Conceitos Banco de Dados I Introdução Conceitos Prof. Rodrigo Rocha prof.rodrigorocha@yahoo.com Apresentação Prof. Rodrigo Rocha prof.rodrigorocha@yahoo.com Ementa Conceitos Fundamentais de Banco de Dados; Características

Leia mais

Conteúdo Programático. Conceitos básicos Modelo entidade relacionamento Normalização

Conteúdo Programático. Conceitos básicos Modelo entidade relacionamento Normalização Banco de dados I Conteúdo Programático Conceitos básicos Modelo entidade relacionamento Normalização Bibliografia HEUSER, Carlos A. Projeto de Bancos de Dados. Sagra, 1998. (Livrotexto) MACHADO, Felipe

Leia mais

Conceitos básicos. Aplicações de banco de dados. Conceitos básicos (cont.) Dado: Um fato, alguma coisa sobre a qual uma inferência é baseada.

Conceitos básicos. Aplicações de banco de dados. Conceitos básicos (cont.) Dado: Um fato, alguma coisa sobre a qual uma inferência é baseada. Conceitos básicos Angélica Toffano Seidel Calazans E-mail: angelica_toffano@yahoo.com.br Conceitos introdutórios de Modelagem de dados Dado: Um fato, alguma coisa sobre a qual uma inferência é baseada.

Leia mais

Banco de Dados. Arquitetura e Terminologia. Prof. Walteno Martins Parreira Jr www.waltenomartins.com.br waltenomartins@yahoo.

Banco de Dados. Arquitetura e Terminologia. Prof. Walteno Martins Parreira Jr www.waltenomartins.com.br waltenomartins@yahoo. Banco de Dados Arquitetura e Terminologia Prof. Walteno Martins Parreira Jr www.waltenomartins.com.br waltenomartins@yahoo.com 2015 Modelo de Dados e Esquemas O modelo de Banco de Dados é como um detalhamento

Leia mais

Conjunto de conceitos que podem ser usados para descrever a estrutura de um banco de dados

Conjunto de conceitos que podem ser usados para descrever a estrutura de um banco de dados CONCEITOS Modelo de Dados Conjunto de conceitos que podem ser usados para descrever a estrutura de um banco de dados Tipos de dados, relacionamentos e restrições Operações dinâmicas alto nível: ou modelo

Leia mais

Banco de Dados. Aula 1 - Prof. Bruno Moreno 16/08/2011

Banco de Dados. Aula 1 - Prof. Bruno Moreno 16/08/2011 Banco de Dados Aula 1 - Prof. Bruno Moreno 16/08/2011 Roteiro Apresentação do professor e disciplina Definição de Banco de Dados Sistema de BD vs Tradicional Principais características de BD Natureza autodescritiva

Leia mais

Aula 02 Modelagem de Dados. Banco de Dados. Aula 02 Modelagem de Dados. Superior /2011 Redes Computadores - Disciplina: Banco de Dados -

Aula 02 Modelagem de Dados. Banco de Dados. Aula 02 Modelagem de Dados. Superior /2011 Redes Computadores - Disciplina: Banco de Dados - Banco de Dados Aula 02 Modelagem de Dados Roteiro Definição Evolução Projeto de BD Abstração Esquema e Instância Definição É uma representação, normalmente gráfica, de estruturas de dados reais. Auxilia

Leia mais

BANCO DE DADOS AULA - 01. Josino Rodrigues (josinon@gmail.com) Weyler N M Lopes Especialização em Banco de Dados Página 1

BANCO DE DADOS AULA - 01. Josino Rodrigues (josinon@gmail.com) Weyler N M Lopes Especialização em Banco de Dados Página 1 BANCO DE DADOS AULA - 01 Josino Rodrigues (josinon@gmail.com) Weyler N M Lopes Especialização em Banco de Dados Página 1 Introdução à Sistemas de Informação Sociedade agrícola Sociedade industrial Obra-prima

Leia mais

Banco de Dados I. Apresentação (mini-currículo) Conceitos. Disciplina Banco de Dados. Cont... Cont... Edson Thizon (edson@esucri.com.

Banco de Dados I. Apresentação (mini-currículo) Conceitos. Disciplina Banco de Dados. Cont... Cont... Edson Thizon (edson@esucri.com. Sistemas da Informação Banco de Dados I Edson Thizon (edson@esucri.com.br) 2008 Apresentação (mini-currículo) Formação Acadêmica Mestrando em Ciência da Computação (UFSC/ ) Créditos Concluídos. Bacharel

Leia mais

INTRODUÇÃO. Diferente de Bando de Dados

INTRODUÇÃO. Diferente de Bando de Dados INTRODUÇÃO Diferente de Bando de Dados 1 INTRODUÇÃO DADOS São fatos conhecidos que podem ser registrados e que possuem significado. Ex: venda de gasolina gera alguns dados: data da compra, preço, qtd.

Leia mais

Bases de Dados. Bibliografia. 1. Parte I Componente Teórica. Pedro Quaresma

Bases de Dados. Bibliografia. 1. Parte I Componente Teórica. Pedro Quaresma Índice Bases de Dados Pedro Quaresma Departamento de Matemática Universidade de Coimbra 2010/2011 1. Parte I Componente Teórica 1.1 Introdução 1.2 Modelo ER 1.3 Modelo Relacional 1.4 SQL 1.5 Integridade

Leia mais

MSc. Daniele Carvalho Oliveira

MSc. Daniele Carvalho Oliveira MSc. Daniele Carvalho Oliveira AULA 2 Administração de Banco de Dados: MSc. Daniele Oliveira 2 CONCEITOS FUNDAMENTAIS DE BANCO DE DADOS Administração de Banco de Dados: MSc. Daniele Oliveira 3 Conceitos

Leia mais

Modelo de Dados. Modelos Conceituais

Modelo de Dados. Modelos Conceituais Modelo de Dados Modelo para organização dos dados de um BD define um conjunto de conceitos para a representação de dados exemplos: entidade, tabela, atributo,... existem modelos para diferentes níveis

Leia mais

Introdução à Banco de Dados

Introdução à Banco de Dados Introdução à Banco de Dados Introdução à Banco de Dados Agenda O que é Banco de Dados Como ele funciona Sistema Gerenciador de Banco de Dados Modelagem de Dados Modelo de dados Entidade-Relacionamento

Leia mais

Softwares Aplicativos Banco de Dados

Softwares Aplicativos Banco de Dados Softwares Aplicativos Banco de Dados INTRODUÇÃO À ENGENHARIA DA COMPUTAÇÃO Professor: Rosalvo Ferreira de Oliveira Neto Estrutura 1. Definições 2. Serviços 3. Usuários 4. Evolução 5. Exemplos 03 Banco

Leia mais

Modelos de Dados e Arquitetura de um SGBD. Introdução 1º Bimestre Prof. Patrícia Lucas

Modelos de Dados e Arquitetura de um SGBD. Introdução 1º Bimestre Prof. Patrícia Lucas Modelos de Dados e Arquitetura de um SGBD Introdução 1º Bimestre Prof. Patrícia Lucas Abstração Modelo de Dados Conjunto de conceitos que podem ser utilizados para descrever a estrutura lógica e física

Leia mais

GBD PROF. ANDREZA S. AREÃO

GBD PROF. ANDREZA S. AREÃO GBD PROF. ANDREZA S. AREÃO Dado, Informação e Conhecimento DADO: Estímulos captados pelos sentidos humanos; Símbolos gráficos ou sonoros; Ocorrências registradas (em memória, papel, etc.); Indica uma situação

Leia mais

MODELAGEM DE DADOS. Banco de Dados I. O uso da análise e do projeto Orientados a Objetos atenuou a separação! Unidade I

MODELAGEM DE DADOS. Banco de Dados I. O uso da análise e do projeto Orientados a Objetos atenuou a separação! Unidade I O uso da análise e do projeto Orientados a Objetos atenuou a separação! 1 Etapas do Projeto do BD Análise de Requisitos Coleta de informações sobre os dados e seus relacionamentos na organização Projeto

Leia mais

Roteiro. Modelo de Dados Relacional. Processo de Projeto de Banco de Dados. BCC321 - Banco de Dados I. Ementa. Posicionamento.

Roteiro. Modelo de Dados Relacional. Processo de Projeto de Banco de Dados. BCC321 - Banco de Dados I. Ementa. Posicionamento. Roteiro Modelo de Dados Relacional Posicionamento Luiz Henrique de Campos Merschmann Departamento de Computação Universidade Federal de Ouro Preto luizhenrique@iceb.ufop.br www.decom.ufop.br/luiz Introdução

Leia mais

CONCEITOS E ARQUITETURA DO SISTEMA DE BANCO DE DADOS

CONCEITOS E ARQUITETURA DO SISTEMA DE BANCO DE DADOS riuningá UNIDADE DE ENSINO SUPERIOR INGÁ FACULDADE INGÁ DEPARTAMENTO DE CIÊNCIA DA COMPUTAÇÃO ERINALDO SANCHES NASCIMENTO CONCEITOS E ARQUITETURA DO SISTEMA DE BANCO DE DADOS MARINGÁ 2014 SUMÁRIO 3 ARQUITETURA...3

Leia mais

BANCO DE DADOS aula 01 - introdução -

BANCO DE DADOS aula 01 - introdução - INSTITUTO DE EXATAS E TECNOLÓGICAS Curso de Ciência da Computação BANCO DE DADOS aula 01 - introdução - professor: Juliano Varella de Carvalho 1.1 Apresentação Apresentação: - nome: Juliano Varella de

Leia mais

UNIVERSIDADE VEIGA DE ALMEIDA CURSO DE BACHARELADO EM CIÊNCIA DA COMPUTAÇÃO CURSO SUPERIOR DE TECNOLOGIA EM PROCESSAMENTO DE DADOS BANCO DE DADOS

UNIVERSIDADE VEIGA DE ALMEIDA CURSO DE BACHARELADO EM CIÊNCIA DA COMPUTAÇÃO CURSO SUPERIOR DE TECNOLOGIA EM PROCESSAMENTO DE DADOS BANCO DE DADOS CURSO DE BACHARELADO EM CIÊNCIA DA COMPUTAÇÃO CURSO SUPERIOR DE TECNOLOGIA EM PROCESSAMENTO DE DADOS CLAUDIO RIBEIRO DA SILVA MARÇO 1997 2 1 - CONCEITOS GERAIS DE 1.1 - Conceitos Banco de Dados - Representa

Leia mais