MODELAGEM MOLECULAR APLICADA AO PLANEJAMENTO DE COMPOSTOS BIOATIVOS: PRINCÍPIOS E APLICAÇÕES

Tamanho: px
Começar a partir da página:

Download "MODELAGEM MOLECULAR APLICADA AO PLANEJAMENTO DE COMPOSTOS BIOATIVOS: PRINCÍPIOS E APLICAÇÕES"

Transcrição

1 MODELAGEM MOLECULAR APLICADA AO PLANEJAMENTO DE COMPOSTOS BIOATIVOS: PRINCÍPIOS E APLICAÇÕES Dr. Carlos Mauricio R. Sant Anna GPAQ, Dequim, UFRuralRJ LASSBio - UFRRJ

2 Bibliografia Indicada 2 Para quem está começando hoje: SANT'ANNA, C. M. R., Métodos de Modelagem Molecular para Estudo e Planejamento de Compostos Bioativos: Uma Introdução. Revista Virtual de Química, 1, 49-57, SANT'ANNA, C. M. R., Glossário de Termos Usados no Planejamento de Fármacos (Recomendações da IUPAC para 1997). Química Nova., v.25, p , Para quem quer saber mais: Molecular Modelling: Principles and Applications ( A. Leach) Introduction to Computational Chemistry (F. Jensen) Computational Chemistry using the PC (D. W. Rogers) Computational Chemistry (D. C. Young) Introdução à Química Computacional (L. Alcácer) Molecular Modeling: Basic Principles and Applications (H. D. Holtje) Programas:

3 O Que é Modelagem Molecular? 3 A Modelagem Molecular faz uso de diferentes teorias e programas de computador para criar modelos da estrutura molecular e prever suas propriedades (como sua energia). Em Química Medicinal, a modelagem molecular é usada para se fazer o Planejamento de Fármacos Auxiliado por Computadores (CADD, do inglês Computer Assisted Drug Design). As estratégias empregadas para o CADD são divididas em dois grandes grupos, o Planejamento de Fármacos Baseado na Estrutura dos Ligantes (LBDD, do inglês Ligand Based Drug Design) e o Planejamento de Fármacos Baseado na Estrutura do Receptor (SBDD, do inglês Structure Based Drug Design. Muitas técnicas são aplicadas na construção dos modelos na Modelagem Molecular e as mais importantes serão discutidas durante o Curso.

4 4 O Que a Modelagem Molecular pode de fato fazer em Química Medicinal? Isso? Ou isso?

5 5 Estratégias Gerais da Descoberta de fármacos Bibliotecas de produtos naturais (de plantas, animais marinhos, processos fermentativos) ou de compostos sintéticos ou novas estruturas obtidas com o uso de química combinatória Conhecimento parcial ou completo do mecanismo de interação entre o composto bioativo (ligante) e o alvo biológico Modelagem Molecular Screening Modelagem Molecular Planejamento racional Protótipo Protótipo Modelagem Molecular Otimização estrutural Modelagem Molecular Otimização estrutural

6 6 Screening : Estratégias reais X virtuais computacional Biblioteca de estruturas reais HTS Biblioteca de estruturas virtuais e/ou reais Screening virtual Protótipo (IC 50 ~ 10 mm) Modificação estrutural IC 50 ~ 1-10 nm Planejamento da modificação Estágio de geração de protótipos Estágio de otimização experimental

7 7 Modelagem Molecular no Planejamento Racional de Compostos Bioativos Docking Relações Qualitativas e Quantitativas entre a Estrutura e a Atividade Modelagem Molecular: Geração de estruturas moleculares para... Planejamento de novo Estudos de mecanismos de reação, etc...

8 8 Visualização em Modelagem Molecular: Gráficos Moleculares

9 Gráficos Moleculares 9 zirconoceno porina

10 Gráficos Moleculares 10 Complexo Proteína-RNA

11 Visualização de Modelos: Proteínas 11

12 Visualização de Modelos: Proteínas 12

13 13 Visualização de Modelos: Superfícies

14 14 Visualização de Modelos: Superfícies Potencial eletrostático mapeado sobre a superfície molecular (Bujnicki et al. BMC Bioinformatics :2 doi: / )

15 Definição de Geometria Molecular 15 Coordenadas cartesianas Formato PDB

16 Definição de Geometria Molecular 16

17 Modelagem Molecular: 17 Classificações dos Métodos Quanto à Dinâmica do Método de Cálculo da Energia Métodos de otimização estrutural direta (busca do ponto estacionário mais próximo) Métodos de otimização múltipla (métodos estatísticos, análise sistemática...) Métodos dinâmicos: geração de trajetórias (dinâmica molecular...) Quanto ao Tipo do Método de Cálculo da Energia Métodos de Campo de Força: mecânica molecular Métodos Quânticos: Semiempíricos, ab initio HF, MP, DFT Métodos de Simulação: métodos de energia livre, métodos de perturbação termodinâmica, métodos de integração termodinâmica

18 Métodos Empíricos 18 Realidade Ótimo ligações

19 Métodos Empíricos 19 ângulos

20 Métodos Empíricos 20 Exemplos de parâmetros: C sp 3 C sp 3 r 0 = 1,526 Å k b = 310,0 kcal/(mol Å 2 ) θ 0 = 109,50 K θ = 40,0 kcal/(mol rad 2 ) C sp 2 O sp 2 r 0 = Å k b = 656,0 kcal/(mol Å 2 ) Quanto maior o valor de k, maior a energia necessária para deformar uma distância ou um ângulo de ligação. Potenciais rasos são obtidos com valores de k entre 0,1 e 1.

21 Métodos Empíricos 21 diedros

22 Métodos Empíricos 22

23 Métodos Empíricos 23 regime de repulsão regime de atração de van der Waals energia ótima termo de van der C.M.R. Waals Sant'Anna, 2014 termo eletrostático

24 24 E pot 2 2 l l k k 1 n kl 0 0 cos l k 2 l l l ' l ' k ' ' k l l kll' 0 0 ' 0 0 l 0 0 l i l' ' l 0 ' 0 ' k' ' A ij ij k ' cos 12 6 ' ' i ji rij rij q q Campo de força padrão para kl 3cos k cos l i j k l 3 ji Dqr ij k kl Drkl i l cos 2 r moléculas orgânicas il q i D l q B D cos Campo de força compostos organometálicos l Classe I ou harmônicos: Sem termos cruzados Ex.: CHARMM, AMBER Classe II: Termos cruzados e séries Ex.: MM4 E l k l 2 D1 exp l l 2 l l 0 E l 0 E k 2 E k 1 cosn 0

25 25 Métodos Empíricos: Exemplos de Campos de Força Campo de Força EFF MM3 CVFF Tripos MMFF Dreiding Amber CHARMM GROMOS MOMEC Sistemas Moleculares Alcanos Geral Geral Geral Geral Geral Proteínas, ácidos nucleicos, carboidratos Proteínas Proteínas, ácidos nucleicos, carboidratos Compostos de coordenação

26 26 A Superfície de Energia Potencial

27 Busca Direta de Mínimos de Energia 27 E i E min Ei E min

28 28 Análise Conformacional Sistemática: Pesquisa de Grade O número de conformações necessárias para varrer o espaço conformacional cresce rapidamente: quando o número de ligações com rotação livre é 6, por exemplo, o número de confôrmeros a ser avaliado é ( igual a 60 0 ). O número de confôrmeros equivale a (360 0 /) n, onde é o incremento usado no processo de varredura e n é o número de ligações avaliadas.

29 Dinâmica Molecular 29 Termodinâmica Quais estados são possíveis? Cinética Como e com que velocidade os estados se interconvertem? O movimento molecular está presente em praticamente todos os processos químicos, como reações, interações intermoleculares, mudanças de fase, solubilizações ou simplesmente em vibrações moleculares (espectroscopia de IV). As etapas em um processo de minimização de energia são dirigidas simplesmente para a busca do mínimo mais próximo. As etapas na dinâmica representam todas as mudanças nas posições atômicas no tempo (as velocidades).

30 Dinâmica Molecular 30 MD: Algoritmo simplificado Dê aos átomos posições iniciais defina Dt curto. Calcule forças Mova átomos: Avance no tempo: Repita tantas vezes quanto for necessário

31 Dinâmica Molecular 31 Campo de força usado em DM deve ser apropriado para representar forças intermoleculares e vibrações longe do equilíbrio. Entre os campos mais usados estão o GROMOS e o OPLS. Dinâmica de aquecimento Dinâmica de equilibração Dinâmica de produção Análise das trajetórias

32 Método de Monte Carlo 32 MC compara energias. Forças não são calculadas. No equilíbrio a T: Algoritmo de Monte Carlo Gere a estrutura inicial R. Calcule V(R). Modifique a estrutura para R. Calcule V (R ). Repita para N etapas.

33 Métodos Quânticos: Introdução 33 A mecânica quântica mostra que as partículas têm comportamento ondulatório. Se é assim, como determinar sua energia? é a chamada função de onda e E é a energia. E. Schrödinger

34 Métodos Quânticos para Moléculas 34 Nos métodos quânticos, a energia da estrutura molecular é definida colocando-se os núcleos em regiões nas quais os elétrons estão associados a orbitais, regiões do espaço definidas pela resolução da equação de Schrödinger. E H Representação de orbitais moleculares para a molécula de H 2

35 35 Diagramas de Orbitais Moleculares: Exemplos

36 36 Métodos Quânticos: Soluções Práticas Métodos de orbital molecular Ab initio Hartree-Fock, Perturbação Moeller-Plesset (MPn), Interação de configuração (CI), etc. Teoria do funcional de densidade (DFT) Métodos de orbital molecular semiempíricos Hückel, PPP, CNDO, INDO, MNDO, AM1 PM3, PM6, RM1

37 Métodos Quânticos: Aproximações 37 Aproximação de Born- Oppenheimer A descrição de moléculas é feita pela resolução da equação de Schrödinger na qual a função de onda é uma função das coordenadas dos núcleos (R) e dos elétrons (r): H(R,r) = E(R,r) (1.1) Como os núcleos são milhares de vezes mais pesados do que os elétrons, os movimentos nuclear e eletrônico podem ser considerados separadamente (Born-Oppenheimer): H(R) = E (R) (1.2) H(r;R) = E (r;r) (1.3) A resolução de (1.2) é chamada dinâmica quântica e depende de uma função de energia (a SEP) definida apenas pelas posições dos núcleos, E(R). Métodos ab initio resolvem (1.3) diretamente. Ex.: HF, MPx Métodos semi-empíricos fazem aproximações que são compensadas com funções ajustadas empiricamente.

38 Métodos Quânticos: Orbitais Atômicos 38

39 Conjuntos de Base Mínimo O mais simples deste conjunto de bases ainda usado é o STO-3G (acrônimo para Orbitais do Tipo Slater simulados pela soma de 3 Gaussianas). O conjunto de bases mínimo tem apenas o número de bases necessário para acomodar os elétrons dos átomos e reter a simetria esférica. Assim, o conjunto STO-3G tem apenas uma função para o H (1s), cinco para o Li até o Ne (1s, 2s, 2p x, 2p y e 2p z ) e 9 para os elementos do segundo período Na até o Ar (1s, 2s, 2p x, 2p y, 2p z, 3s, 3p x, 3p y e 3p z ). É o conjunto de bases usados pelos hamiltonianos do programa Mopac. Problemas: estabilidade de anéis pequenos é superestimada

40 Conjuntos de Base Conjunto de Bases de Valência Dividida Os orbitais são divididos em pelo menos duas partes: uma interna e compacta e outra externa, mais difusa. Os coeficientes das duas partes podem ser variados independentemente na combinação LCAO-MO. Assim, o tamanho do orbital pode ser variado dentro dos limites das funções interna e externa. Exemplos: 3-21G, 6-31G, 6-311G (notação de Pople)... Uma contração de 6 funções Gaussianas usadas para representar os orbitais de camada interna 1 função Gaussiana usada para representar a parte intermediária dos orbitais de valência 6-311G Uma contração de 3 funções Gaussianas usadas para representar a parte interna dos orbitais de valência 1 função Gaussiana usada para representar a parte externa dos orbitais de valência

41 Conjuntos de Base Conjunto de Bases com Funções de Polarização Melhoria nas funções de base foi obtida pela adição de funções do tipo d para todos os átomos pesados (diferentes de H). Por ser mais conveniente computacionalmente, são usadas 6 funções do tipo d (x 2, y 2, z 2, xy, xz, yz), que equivalem a 5 funções d e a uma função s. Essas funções permitem que o centro de um orbital se desloque para além do plano que contém o núcleo, levando à distribuições eletrônicas não-esféricas (anisotrópicas). A presença do conjunto de polarização é indicada por um asterisco. Ex.: 3-21G* Funções de polarização também podem ser usadas para os átomos de H. Nesse caso, são usadas funções do tipo p. A presenças destas funções é indicada por um segundo asterisco. Ex.: 6-31G** Um asterisco entre parênteses indica que as funções de polarização foram adicionadas apenas para os elementos do segundo período. Uma maneira alternativa de indicar a presença de funções de polarização é colocar (d) ou (d,p) após o G.

42 Conjuntos de Base Conjunto de Bases com Funções Difusas Sistemas com elétrons mais fracamente ligados aos núcleos, como ânions ou mesmo átomos com elétrons não-ligantes, são melhor descritos pela inclusão de funções difusas. Essas funções são conjuntos de orbitais s e p muito difusos, com expoentes entre 0,1 e 0,01. A presença das funções difusas nos átomos pesados é indicada por um sinal + antes da letra G. Ex.: 6-31+G A presença das funções difusas também nos átomos de H é indicada por um segundo sinal +. Ex.: G Processos que envolvem mudança no número pares de elétrons solitários, como reações de protonação, são melhor descritas com o uso das funções difusas. A adição de funções difusas nos átomos de H tem, em geral, pouco efeito nos resultados, a não ser nos casos em que íons hidretos estejam envolvidos.

43 43 Método HF e Sistemas com Elétrons Desemparelhados No método HF, os elétrons devem ocupar os orbitais em pares, ou seja, a mesma função de onda do orbital é usada para os elétrons nos 2 estados de spin ( e ); isso é chamado de método de Hartree-Fock restrito (RHF). Para sistemas com elétrons desemparelhados, como os radicais livres, uma alternativa é usar conjuntos separados de orbitais para os elétrons e ; isso é chamado de método de Hartree-Fock irrestrito (UHF). Por exemplo:

44 Modelos de Correlação Eletrônica 44 Uma maneira de incluir a correlação eletrônica é a Interação de Configuração (CI): uma certa quantidade de estados eletrônicos excitados são incluidos na descrição de um estado eletrônico. Em geral, uma função de onda CI para uma molécula pode ser escrita como: c 0 c onde 0 é a função de onda para um dado orbital molecular, obtida ao se resolver as equações de HF e 1, etc. são funções de configurações onde um ou mais dos orbitais ocupados são substituídos por orbitais virtuais. O método CI é computacionalmente muito mais custoso do que os métodos HF (tempo de CPU pode ser proporcional entre N 6 a N 10, onde N é o número de orbitais).

45 45 Modelos de Correlação Eletrônica No Modelo de Möller-Plesset (MP), as funções de onda e as energias podem ser gradualmente melhoradas substituindo-se o hamiltoniano verdadeiro H l por: Hˆ l Hˆ 0 l onde l é um parâmetro que varia entre 0 e 1, V é a perturbação e H 0 é o hamiltoniano de ordem zero. Assim, para as funções de onda e energias: Vˆ E i i E (0) i (0) i l le (1) i (1) i 2 l 2 l E (2) i (2) i onde E i (1) é a correção de primeira ordem da energia, E i (2) é a de segunda ordem, etc.: De acordo com a ordem da correção introduzida, temos os vários modelos de Möller-Plesset: MP2, MP3, MP4

46 Métodos Semi-empíricos 46 Nos métodos semi-empíricos, a energia total da molécula é representada como a soma da energia eletrônica com a energia de repulsão entre os cernes. Um conjunto de treinamento de moléculas é selecionado, escolhido para cobrir o maior número de situações de ligação química possível. É aplicado um procedimento de mínimos quadrados não-linear com os valores dos parâmetros ajustáveis sendo as variáveis as propriedades do conjunto de treinamento como constantes a serem reproduzidas. Estas propriedades incluem calores de formação, variáveis geométricas, momentos de dipolo, energias de ionização, etc. Dependendo da escolha do conjunto de treinamento, do número de parâmetros ajustáveis e do modo de ajuste às propriedades experimentais, temos diferentes hamiltonianos; por exemplo: AM1 (M. J. S. Dewar et al.) PM3, PM5, PM6 e PM7 (J. J. P. Stewart) RM1 (G. B. Rocha et al.)

47 Métodos Semi-empíricos moléculas contendo H, C, N, O, P, S, F, Cl, Br e I. RM1: a Reparameterization of AM1 for H, C, N, O, P, S, F, Cl, Br, and I Gerd Bruno Rocha, Ricardo Oliveira Freire, Alfredo Mayall Simas, and James J. P. Stewart. Journal of Computational Chemistry 27(10), , 2006

48 48 J. J. P Stewart, J. Mol. Model. 2007, 13, Parâmetros semi-empíricos para 70 elementos da tabela periódica.

49 49 J. J. P Stewart, J. Mol. Model. 2007, 13,

50 50 Desempenho Relativo dos Métodos de Cálculo de Modelagem Molecular Objetivo Geometria (grupo principal) Geometria (metais de transição) Geometria (ests. de transição) Mecânica Molecular Semi-empírico HF Ab Initio MP2 aceit.bom Bom Bom Bom - Bom Pobre? - Bom Bom Bom Conformação Bom Pobre aceit.bom Bom Termoquímica - Pobre aceit.bom Bom (não isodêsmica) Termoquímica - aceitável Bom Bom (isodêsmica) Custo muito baixo baixo alto muito alto

51 51 Um Modelo Quântico Alternativo: Teoria do Funcional de Densidade Structure and Bonding, Vol. 150 Putz, Mihai V.; Mingos, D Michael P (Eds.) 2013, XII, 236 p. Número de artigos com a palavra DFT no título a partir de 1980

52 Teoria do Funcional de Densidade 52 Na Teoria do Funcional de Densidade (DFT), todas as propriedades do sistema são uma função de uma função (um funcional), a densidade eletrônica r (1 o teorema de Hohenberg e Kohn). Como obter a densidade eletrônica? A densidade eletrônica é expressa como uma combinação linear de funções de base matematicamente semelhantes aos orbitais HF, chamados orbitais de Khon- Sham. Há várias formas de funcionais. Alguns foram desenvolvidos a partir da mecânica quântica fundamental (ab initio) e outros que foram parametrizados para melhor reproduzir dados experimentais (semi-empíricos). i r i K ( r) i E i i r

53 Principais Funcionais de Densidade 53 Os funcionais mais simples tem apenas um termo de troca eletrônica (ex.: X); outros incluem termos de correlação eletrônica, como nos métodos da aproximação de densidade local (LDA) e de densidade de spin local (LSDA). Métodos mais complexos (e mais precisos) usam a densidade e o seu gradiente (gradiente-corrigido) e alguns misturam partes de diferentes funcionais (híbridos). Os mais completos têm uma qualidade equivalente a um cálculo MP2. Alguns exemplos: Acrônimo Nome Tipo X X alfa Troca HFS Hartree, Fock e Slater HF com troca LDA VWN Vosko, Wilks e Nusair LDA BLYP Funcional de correlação de Becke com de troca de Lee, Gradiente-corrigido Yang, Parr B3LYP Termo 3 de Becke com de troca de Lee, Yang, Parr Híbrido PW91 Perdue e Wang 1991 Gradiente-corrigido G96 Gill 1996 Troca P86 Perdew 1986 Gradiente-corrigido B96 Becke 1996 Gradiente-corrigido B3P86 Troca de Becke, correlação de Perdew Híbrido B3PW91 Troca de Becke, correlação de Perdew e Wang Híbrido

54 Aplicações: Propriedades Eletrônicas 54 Cátion t-butil: mapas de potencial eletrostático Formaldeído: LUMO Formaldeído: HOMO

55 55 Aplicações: Estudo da Reatividade Química Representação do LUMO dos substratos acetaldeído e triflúor-acetaldeído (método quântico semi-empírico AM1) Representação superfície de potencial eletrostático dos substratos acetaldeído e triflúor-acetaldeído (método quântico semi-empírico AM1)

56 56 Aplicações: Estudo da Reatividade Química S N 2: representação do LUMO do substrato CH 3 Br obtido pelo método quântico semi-empírico AM1 S N 1: representação do LUMO do intermediário cátion t-butil obtido pelo método quântico semi-empírico AM1

57 Qual o Melhor Modelo? 57 Os principais parâmetros para a escolha de um modelo teórico são o desempenho e o custo. O sucesso de qualquer modelo depende primeiro da sua capacidade de reproduzir dados experimentais. Mas um modelo precisa também ser prático, o que depende do tamanho do sistema em estudo e das facilidades computacionais disponíveis. Um modelo prático provavelmente não vai ser o melhor tratamento possível para um determinado problema, mas aquele que produzirá as informações necessárias com uma precisão e um custo razoáveis.

58 Métodos Híbridos 58 Nos chamados métodos híbridos (ou combinados) QM/MM (do inglês Quantum Mechanics/Molecular Mechanics), os métodos clássico e quântico são usados ao mesmo tempo, mas em camadas diferentes deste sistema. O cálculo quântico é aplicado em uma parte pequena da estrutura (chamada parte quântica), enquanto o restante da estrutura é tratado com um método clássico (a parte clássica). Vantagens: Como a região tratada quanticamente é pequena, os resultados podem ser alcançados com rapidez, mesmo que sejam usados conjuntos de base extensos. Problemas: definição da fronteira quântico/clássico (uso de hidrogênios para completar ligações cortadas? orbitais localizados congelados?) Exs.: integrated MO MM (IMOMM); our own n-layered integrated MO and MM method (ONIOM); integrated MO MO method (IMOMO). Warshel & Levitt, Journal of Molecular Biology, 103, 1976,

59 Modelagem de Proteínas Modelagem Comparativa (por Homologia) Esse método aproxima a estrutura tridimensional para sequências primárias de proteínas, usando como molde estruturas 3D conhecidas. É necessário ~30% de identidade entre as sequências da proteína a ser modelada (proteína-alvo) e do molde. As estruturas 3D são conhecidas através de dados de cristalografia de raios-x ou, mais raramente, dados de RMN. Muitas estão depositadas em bancos de acesso público, como o Protein Data Bank (PDB). Ex.: Swiss-Model, Modeller. 2. Modelagem ab initio (de novo) Baseia-se em princípios físicos ao invés do uso de moldes. Há métodos que tentam mimetizar o processo de enovelamento de proteínas e outros que aplicam métodos estocásticos para pesquisar possíveis soluções estruturais. São métodos computacionalmente muito exigentes e foram aplicados com sucesso em proteínas pequenas. Ex.: I-TASSER,

60 Modelagem de Proteínas 60 Etapas da Modelagem Comparativa (por Homologia) 1. Busca do molde a partir da sequência da proteína-alvo usando um algoritmo de similaridade. Ex.: Blast no Swiss-Model. (semelhança e resolução) 2. Alinhamento das sequências. Ex.: ClustalW e T-Coffee (problemas: inserções e deleções, loops). 3. O backbone do alvo é construido sobre o do molde (C e ângulos e ). 4. Ajuste das cadeias laterais (bibliotecas de confôrmeros ajudam); eliminação de colisões (clashes) 5. Refinamento da estrutura por simples minimização de energia com mecânica molecular ou por dinâmica molecular. Molde Estrutura 3D desconhecida loop Alinhamento das sequências deleções inserção Modelo estrutural

61 Modelagem de Proteínas 61 >tr Q4CQE2 Q4CQE2_TRYCR Ribose 5-phosphate isomerase, putative OS=Trypanosoma cruzi GN=Tc PE=4 SV=1 MTRRVAIGTDHPAFAIHENLILYVKEAGDEFVPVYCGPKTAESVDYPDFASRVAEMVARK EVEFGVLACGSGIGMSIAANKVPGVRAALCHDHYTAAMSRIHNDANIVCVGERTTGVEVI REIIITFLQTPFSGEERHVRRIEKIRAIEASHAGKKGVQ >[Template] 1nn4D 2.2 Structural Genomics RpiBAlsB Length = 159 Arquivo FASTA (Swiss-Prot) Alinhamento [Display Alignment in DeepView] Score = 114 bits (286), Expect = 2e-26, Method: Composition-based stats. Identities = 60/147 (40%), Positives = 93/147 (63%), Gaps = 3/147 (2%) Query: 3 RRVAIGTDHPAFAIHENLILYVKEAGDEFVPVYCGPKTAESVDYPDFASRVAEMVARKEV A G DH F E G E + G ++E DYP +AS+VA VA EV Sbjct: 14 KKIAFGCDHVGFILKHEIVAHLVERGVEVIDK--GTWSSERTDYPHYASQVALAVAGGEV 71 Query: 63 EFGVLACGSGIGMSIAANKVPGVRAALCHDHYTAAMSRIHNDANIVCVGERTTGVEVIRE G+L CG+G+G+SIAANK G+RA +C + Y+A +SR HND N++ G R G+E+ + Sbjct: 72 DGGILICGTGVGISIAANKFAGIRAVVCSEPYSAQLSRQHNDTNVLAFGSRVVGLELAKM 131 Query: 123 IIITFLQTPFSGEERHVRRIEKIRAIE 149 I+ +L + G RH +R+E I AIE Sbjct: 132 IVDAWLGAQYEG-GRHQQRVEAITAIE 157

62 Modelagem de Proteínas: Swiss-Model 62

63 Modelagem de Proteínas: Swiss-Model 63

64 Modelagem de Proteínas 64 Molde Modelo Modelo gerado a partir do servidor Swiss-Model (modo automático); otimização estrutural com campo de força GROMOS Ferramentas avaliam a qualidade do modelo. Ex.: gráfico de Ramachandran (Swiss-Model), o servidor ANOLEA

65 Modelagem de Proteínas 65 Há uma variedade de ferramentas desenvolvidas para avaliar a qualidade dos modelos, por exemplo: 1. Procheck (http://www.ebi.ac.uk/thornton-srv/software/procheck/): avalia a qualidade estereoquímica da estrutura; 2. Molprobity (http://molprobity.biochem.duke.edu/): verifica os contatos entre átomos do modelo e a presença de conformações não usuais da cadeia principal e das cadeias laterais dos aminoácidos; 3. ProSA (https://prosa.services.came.sbg.ac.at/prosa.php): usa potenciais de campos de força construídos a partir de uma análise estatística de estruturas 3D conhecidas para avaliar a qualidade do modelo.

66 Ancoramento Molecular ( Docking ) 66 O ancoramento molecular é uma metodologia que tem como objetivo prever o modo de interação (orientação e conformação) do complexo formado entre uma molécula pequena (ligante) e um receptor, geralmente uma proteína. Há diferentes níveis de ancoramento: 1. Ancoramento rígido: apenas o ligante tem liberdade conformacional; 2. Ancoramento semi-rígido: cadeias laterais selecionadas e/ou moléculas de água são mantidas livres; 3. Ancoramento flexível: todas as espécie presentes no complexo são mantidas livres durante o procedimento.

67 Geração de poses: Estratégias 67 Evolução... Estratégias: Algoritmo genético Monte Carlo Construção incremental Métodos híbridos Programa AutoDock FlexX Glide GOLD Estratégia AG/MC CI Híbrido AG Charles Darwin próxima geração Criar população de cromossomos Determinar o ajuste de cada indivíduo Selecionar próxima geração Realizar reprodução por cruzamento várias gerações Mostrar resultados AG: uma máquina Realizar mutação para fazer evolução

68 68 Algoritmo Genético mais Detalhado 1. Um conjunto de operadores de reprodução ( crossover, mutação etc) é escolhido. A cada operador é estipulado um peso. 2. Uma população inicial é randomicamente criada, e a aptidão ( fitness ) de seus membros é determinada. 3. Um operador é escolhido utilizando seleções por roletas de cassino, baseadas no peso de operadores. Um algoritmo genético (AG) é uma técnica de busca utilizada para achar soluções aproximadas em problemas de otimização e busca. Algoritmos genéticos são uma classe particular de algoritmos evolutivos que usam técnicas inspiradas pela biologia evolutiva como hereditariedade, mutação, seleção natural e recombinação. 4. Os pais requeridos pelos operadores são escolhidos utilizando seleções por roletas, baseadas em aptidões escaladas. 5. O operador é aplicado e cromossomos filhos são produzidos. Suas aptidões são avaliadas. 6. Se ainda não estão presentes na população, os cromossomos filhos substituem os membros de menor aptidão (os piores ancorados). 7. Se N operações foram feitas, o cálculo é parado; caso contrário, volta-se ao passo 3.

69 Ancoramento Molecular ( Docking ) 69 Representações Básicas da Proteína e do Ligante: a. Atômica: calcula-se a interação átomo-átomo; é usada com funções de energia potencial. b. Representação em grade: o uso de grades é feito para o cálculo de energia, acumulando informações sobre a contribuição na energia da proteína nos pontos em uma grade. c. Superficial: utilizada para ancoramento entre duas proteínas (ancoramento proteína/proteína), através do alinhamento de pontos de cada superfície. a c

70 Ancoramento Molecular ( Docking ) 70 Funções de escore baseadas em campos de força Para avaliação dos modos de interação de forma rápida são usadas funções que determinam de forma simplificada o processo de interação liganteproteína. Para alguns do programas de docking, essas funções se baseiam apenas na complentaridade estrutural e eletrostática entre enzima e inibidor, usando termos similares às funções de energia estérica e eletrostática dos campos de força da mecânica molecular. E coul ( r) N A N B i j i1 j1 4 0rij q q E vdw ( r) N i1 A N B j1 ij 4 rij 12 ij rij 6

71 Funções empíricas: Essas funções de escore reproduzem dados experimentais como uma soma de várias funções de energia parametrizadas. 71 Ligante H 3 N OH Ângulos diedros com pequenas barreiras em solução + Receptor O Ângulos diedros variados no docking flexível O Sítio de interação na proteína O N H Poses do complexo ligante-receptor O H 3 N O DG io DG rot O DG hb H O N H Classificação das poses DG int = SDG i DG int = DG rot + DG hb + DG ion + DG aro + DG lipo +... DG lipo DG aro Valores usados diretamente ou para gerar outros valores comparativos (escores)

72 Ancoramento Molecular ( Docking ) 72 Algoritmos de Busca Aplicados a Ligantes Flexíveis a. Métodos sistemáticos: fragmentos moleculares são atracados no sítio, sendo então ligados covalentemente um ao outro (construção incremental), podendo ser ainda divididos em regiões rígidas ( núcleos ) e flexíveis (cadeias laterais). b. Métodos estocásticos: atuam promovendo mudanças aleatórias nas poses dos ligantes, de acordo com funções de probabilidade, implementadas principalmente por duas metodologias: Monte Carlo e algoritmo genético. c. Métodos simulacionais: simula-se o movimento real do ligante no interior da proteína; a técnica de dinâmica molecular é a mais utilizada neste tipo de método. Programa AutoDock FlexX Glide GOLD Estratégia AG/MC CI Híbrido AG

73 Ancoramento Molecular ( Docking ) 73 Redocking é o processo no qual um ligante retirado da estrutura de um complexo é ancorado na forma ajustada do receptor. É um processo usado para verificar quais parâmetros para o processo de ancoramento são adequados e capazes de recuperar a estrutura do complexo e suas interações. O cross-docking é feito com um conjunto de complexos, onde todos os ligantes são ancorados em todos os receptores. É útil para determinar a capacidade de separação dos ligantes pelo programa frente a um receptor. Sobreposição das estruturas do FAD co-cristalizado (no padrão CPK de cores) e atracado (em ciano), após ancoramento com o programa GOLD 3.0 na enzima tripanotiona redutase. Átomos de H da proteína omitidos (Del Cistia, C.N., Tese de Doutorado, 2010)

74 Ajuste Induzido: Cadeias Laterais 74 Glu276 Glu276 Arg224 Arg224 Neuraminidase da influenza A complexada com o inibidor ácido 2-desoxi-2,3-desidro-Nacetilneuramínico (PDB 1NNB) e com o ácido 5-acetilamino-4-amino-6- (fenetilpropilcarbamoil)-5,6-diidro-4h-pirano-2-carboxílico (PDB 1BJI). 74

75 Ajuste Induzido: Cadeia Polipeptídica 75 Agonista 17β-estradiol (PDB 1ERE) no domínio de interação do ligante no receptor do estrogênio causa uma conformação diferente da hélice 12, quando comparada com conformação da hélice 12 com o ligante seletivo do receptor do estrogênio raloxifeno C.M.R. (PDB Sant'Anna, 1ERR)

76 76 Ajuste Induzido: Efeito na estrutura terciária SB Efeitos conformacionais na proteína após formação do complexo MAP quinase P38/ligante 76

77 Ajuste induzido: Soluções no docking 77 Ensemble docking docking comum 10 proteínas + 87 ligantes ensemble docking Sobreposição estrutural 75 % de acerto 93 % de acerto Huang e Zhou, Proteins, 2007, 6, Otimização estrutural C.M.R. Sant'Anna, 2012

78 Ajuste induzido: Soluções no docking 78 SB Escore da estrutura SB C.M.R. Sant'Anna, 2012

79 79 Triagem Virtual Baseada no Docking Triagem virtual baseada na estrutura (SBVS Structure Based Virtual Screening) Triagem virtual baseada no docking (DBVS Docking Based Virtual Screening) Preparação da estrutura alvo docking Avaliação das poses ( scoring ) Classificação das poses ( ranking ) Pós-processamento Preparação da biblioteca de compostos

80 80 Seleção de Compostos para o DBVS Bibliotecas: Próprias Públicas Comerciais Comp. 2 Comp. 1 Comp. 3 Comp. 2 Enriquecimento de Bibliotecas (filtragem): Filtros físico-químicos e/ou farmacológicos (ex.: solubilidade, Lipinski, ADME/Tox) Filtros de similaridade c/ compostos ativos conhecidos Filtros baseados no alvo

81 81 Aplicações no Estudo de Compostos Bioativos

82 Is there really a case where a drug that s on the market was designed by a computer? When asked this, I invoke the professorial mantra ( All questions are good questions. ), while sensing that the desired answer is no. Then, the inquisitor could go back to the lab with the reassurance that his or her choice to avoid learning about computational chemistry remains wise....the phrasing of the question suggests misunderstanding and oversimplification of the drug discovery process. There is not going to be a voila` moment at the computer terminal. Instead, there is systematic use of wide ranging computational tools to facilitate and enhance the drug discovery process. 82 SCIENCE MARCH 2004

83 Estratégias no Planejamento Racional 83 Quantidade crescente de informação disponível Ligantes conhecidos (estrutura e QSAR dados biológicos) (CoMFA, etc) Métodos Independentes do Receptor/Enzima + Seqüência do receptor conhecida Modelo do Receptor + Modelagem por homologia Estrutura 3D do receptor conhecida Interações ligante-receptor (docking, etc) Novos ligantes + Métodos Dependentes do Receptor/Enzima Dinâmica das Mecanismo de interações, reações ação conhecido Métodos Baseados no Mecanismo

84 Exemplo 1: Inibidores da PDE4 84 O O CH 3 N O N N N EtO O H N H 3 C O N CH 3 N EtO O S H 3 C O N CH 3 N N H O Cl Cl Cl 1 (rolipram) 2 (syntex 3) 3 4 NC CH 3 O N N CH 3 N H 3 C N O O N CH 3 N H 3 C N O O N N O H 2 N S N CH 3 CH 3 N O H 3 C CH Oliveira, Caffarena, Sant`Anna, Dardenne, Barreiro, 2006 NC S H 3 C O N CH 3 N NC CH 3 O N CH N N CH 3

85 85 Interação Ligante-Receptor: Aspectos Teóricos + [E (aq) ] [I (aq) ] [E I (aq) ] DG bind RT ln K a RT ln K d K i = K d = [E (aq)] [I (aq) ] [E I (aq) ] DG bind DH bind TDS bind Trocas de energias envolvidas no processo de binding, como as energias de interação ligante-sítio e ligante-solvente. Formas de distribuição das energias, classificadas como entropia translacional, rotacional, conformacional e vibracional.

86 86 Atividade Biológica: Construção de Modelos Teóricos Objetivo: proposição de um modelo teórico capaz de determinar a atividade biológica. DG RT ln K i RT ln K i c 1 2 DGsolv c2 c3dh bind c4n LR c5 DH bind DH comp DH sa DH lig N LR : termo entrópico associado à perda de rotação em ligações após associação do ligante ao sítio ativo

87 Calculated DG (kcal/mol) 87 A B C Gln443 Met431 Met Phe Syntex3 0.0 Tyr233 Phe r 2 = 0.92 SD= 0.26 n = Experimental DG (kcal/mol) Metallic subsite

88 88 Exemplo 2: Modelo para a Inibição para a Tripanotiona Redutase Composto R 1 R 2 R 3 R 4 1 Cl (CH 2 ) 3 NMe 2 - H 2 COCH 2 CH 3 (CH 2 ) 3 NMe 2 - H 3 COOH (CH 2 ) 3 NMe 2 - H 4 CONH 2 (CH 2 ) 3 NMe 2 - H 5 H (CH 2 ) 2 C(NH 2 )=NH - H 6 H (CH 2 ) 3 N(CH 2 CH 2 ) 2 NCH 3 - H 7 H CO(CH 2 ) 2 COOH - H 8 H COCH 2 Br - H 9 CF 3 (CH 2 ) 2 C(NH 2 )=NH - H 10 Cl (CH 2 ) 3 NMe 2 - COCH 3 11 Cl (CH 2 ) 3 NMe 2 =O H 12 COCH 3 COCH 3 - H 13 COCH 3 COCH 3 - COCH 3 14 Cl (CH 2 ) 3 N + (Me) 2 CH 2 C 6 H 5 - H 15 Cl (CH 2 ) 3 N + (Me) 2 CH 2 C 6 H 3 3,4-Cl - H 16 Cl (CH 2 ) 3 N + (Me) 2 CH 2 C 6 H 4 4-NO 2 - H 17 Cl (CH 2 ) 3 N + (Me) 2 CH 2 C 6 H 3 3,4-CH 3 - H 18 Cl (CH 2 ) 3 N + (Me) 2 CH 2 C 6 H 3 3,4-OCH 3 - H 19 Cl (CH 2 ) 3 N + (Me) 2 CH 2 C 6 F 5 - H 20 Cl CH 3 - H R 3 S R 1 N R 4 R 2 Docking de fenotiazinas Khan et al., J. Med. Chem., 2000, 43, Chan et al., J. Med. Chem., 1998, 41, 148. TR de Trypanosoma cruzi* *Bond et al., Structure Fold Des., 1999, 7, 81.

89 ln IC 50 calc Docking (GOLD) Melhores ajustes (Goldscore) Geração de descritores para os complexos (SILVER) Seleção de descritores e geração de correlação ln IC 50 c D 1 VDW c 2 D HYD c 3 D AH c 4 89 Comp. l n (IC50) exp l n (IC50) calc 1 2,08 2,24 2 2,3 1,15 3-0,25 1,14 4 2,88 3,43 5 1,69 1,51 6 3,33 3,16 7 4,34 5,52 8 5,16 5,13 9 7,94 6, ,89 5, ,28 4, ,3 8, ,53 5, ,73 6, ,57 4, ,88 4, ,27 6, ,13 5, ,36 1, ,9 5, ,7 5, ,48 2, ,08 7, ln IC 50 exp Linear fit R=0,904 SD=0,871 N=20 D VDW é a contribuição em interações de van de Waals ligante/proteína, D HYD o número de átomos hidrofóbicos do ligante acessíveis ao solvente, D AH o número de aceptores de ligação hidrogênio do ligante e os coeficientes c 1 -c 4 são obtidos ajustando-se a equação aos valores experimentais de ln (IC 50 )

90 90 Exemplo 3: Mesoiônicos, Novos Inibidores da TR NH L. infantum S Cl - R + N N R = H, m-och 3, p-och 3, p-no 2 Espécie L. amazonensis Inibição (%) da TR pelo derivado p-no 2 (1 M) 76 L. infantum 70 L. brasiliensis 69,5 T. cruzi 83 Inibição não competitiva Rodrigues, R., et al., Bioorg. Med. Chem., 20, 1760 (2012) C.M.R. Sant'Anna, 2012

91 Docking TR L. infantum (2W0H) NH N + S N Cl - R TR L. amazonensis (modelo) TR L. brasiliensis (modelo) R = H, m-och 3, p-och 3, p-no 2 TR T. cruzi (1BZL) Sítio do FAD Sítio da tripanotiona Rodrigues, R., et al., Bioorg. Med. Chem., 20, 1760 (2012) Sítio do NADPH 91 C.M.R. Sant'Anna, 2012

92 NH S Cl - R + N N R = H, m-och 3, p-och 3, p-no 2 Sítio do NADPH Rodrigues, R., et al., Bioorg. Med. Chem., 20, 1760 (2012) 92 C.M.R. Sant'Anna, 2012

93 NH N + S N Cl - O N + O - 93 Rodrigues, R., et al., Bioorg. Med. Chem., 20, 1760 (2012) C.M.R. Sant'Anna, 2012

94 Exemplo 4: DBVS aplicado aos 94 receptores A 2A Adenosina Banco de dados inicial 4 subtipos de receptores: A 1, A 2A, A 2B, A 3 Docking MOE Sequência primária do receptor A 2A Modeller Modelagem comparativa Filtragem: 1.Propriedades adequadadas ao CNS; 2. Ausencia de furano ou xantina compostos Langmead et al., J. Med. Chem. 2012, 55, Glyde Otimização estrutural baseada nos resultados do docking de hits selecionados 372 compostos Disponibilidade comercial Binding no receptor A 2A 230 compostos 20 hits IC 50 < 55 M C.M.R. Sant'Anna, 2013

95 Top 10 Hits 95 K i = 3,5 nm Otimização estrutural do composto 1 Docking do composto 15 (Biophysical Mapping) K i = 0,1 nm K i = 1,6 nm Langmead et al., J. Med. Chem. 2012, 55, C.M.R. Sant'Anna, 2013

Tutorial: QUÍMICA COMPUTACIONAL E MODELAGEM MOLECULAR. Profa. Nelilma Correia Romeiro

Tutorial: QUÍMICA COMPUTACIONAL E MODELAGEM MOLECULAR. Profa. Nelilma Correia Romeiro Tutorial: QUÍMICA COMPUTACIONAL E MODELAGEM MOLECULAR Profa. Nelilma Correia Romeiro Fevereiro de 2008 1 MODELAGEM MOLECULAR Modelagem molecular, segundo a IUPAC, é a investigação das estruturas e das

Leia mais

4 Programas computacionais

4 Programas computacionais 4 Programas computacionais No estudo em solução são usados programas computacionais que permitem calcular as constantes de estabilidade dos complexos formados e montar as curvas de distribuição de espécies.

Leia mais

UNIVERSIDADE FEDERAL DE VIÇOSA BIOINFORMÁTICA ESTRUTURAL: PREDIÇÃO DE ESTRUTURA 3D DE PROTEÍNAS

UNIVERSIDADE FEDERAL DE VIÇOSA BIOINFORMÁTICA ESTRUTURAL: PREDIÇÃO DE ESTRUTURA 3D DE PROTEÍNAS UNIVERSIDADE FEDERAL DE VIÇOSA BIOINFORMÁTICA ESTRUTURAL: PREDIÇÃO DE ESTRUTURA 3D DE PROTEÍNAS 2 BIOINFORMÁTICA ESTRUTURAL Área da bioinformática que se aplica ao estudo da estrutura das moléculas Desafio

Leia mais

Química Inorgânica II Professor: Eduardo Cassús

Química Inorgânica II Professor: Eduardo Cassús Química Inorgânica II Professor: Eduardo Cassús Teoria do Orbital Molecular A Teoria do Orbital Molecular usa os métodos da teoria de grupos para descrever a ligação química em moléculas. A simetria e

Leia mais

Modelagem molecular (Parte I) Predição da estrutura e aplicações em

Modelagem molecular (Parte I) Predição da estrutura e aplicações em Modelagem molecular (Parte I) Predição da estrutura e aplicações em engenharia de proteinas Sumario Métodos de determinação da estrutura de proteinas Principios Fundamentais Forças em Biomoléculas Modelagem

Leia mais

Disciplina COD CR CH OB/CO/ELE Sábado Início Término Local Algoritmos e Programação. BCS01 4 60 OB 8h-12h 23/02 01/06

Disciplina COD CR CH OB/CO/ELE Sábado Início Término Local Algoritmos e Programação. BCS01 4 60 OB 8h-12h 23/02 01/06 Horário de aula 1º. Semestre de 2013 Disciplina COD CR CH OB/CO/ELE Sábado Início Término Local Algoritmos e Programação BCS01 4 60 OB 8h-12h 23/02 01/06 Professor: Ementa: Computadores e Ambientes de

Leia mais

AlH3 e Al2H6 : Um estudo por Monte Carlo Quântico e outros métodos Ab-initio.

AlH3 e Al2H6 : Um estudo por Monte Carlo Quântico e outros métodos Ab-initio. AlH3 e Al2H6 : Um estudo por Monte Carlo Quântico e outros métodos Ab-initio. Emanuel M. Isaac Moreira e Ladir C. da Silva. Instituto de Física, Universidade Federal de Goiás, 740001-970, Goiânia, GO,

Leia mais

TEORIA DO ORBITAL MOLECULAR PARA MOLÉCULAS POLIATÔMICAS

TEORIA DO ORBITAL MOLECULAR PARA MOLÉCULAS POLIATÔMICAS UNIVERSIDADE FEDERAL FLUMINENSE INSTITUTO DE QUÍMICA DEPARTAMENTO DE QUÍMICA INORGÂNICA QUÍMICA INORGÂNICA FUNDAMENTAL TEORIA DO ORBITAL MOLECULAR PARA MOLÉCULAS POLIATÔMICAS Prof. Fabio da Silva Miranda

Leia mais

QUÍMICA. LIGAÇÕES QUÍMICAS -GEOMETRIA e POLARIDADE MOLECULAR - HIBRIDIZAÇÃO - FORÇAS INTERMOLECULARES - PIRES

QUÍMICA. LIGAÇÕES QUÍMICAS -GEOMETRIA e POLARIDADE MOLECULAR - HIBRIDIZAÇÃO - FORÇAS INTERMOLECULARES - PIRES QUÍMICA Prof. Daniel Pires LIGAÇÕES QUÍMICAS -GEOMETRIA e POLARIDADE MOLECULAR - HIBRIDIZAÇÃO - FORÇAS INTERMOLECULARES - PIRES 1. Considere as seguintes moléculas: H O; PC؃; BHƒ; SF e CO. a) Indique

Leia mais

Complemento IV Introdução aos Algoritmos Genéticos

Complemento IV Introdução aos Algoritmos Genéticos Complemento IV Introdução aos Algoritmos Genéticos Esse documento é parte integrante do material fornecido pela WEB para a 2ª edição do livro Data Mining: Conceitos, técnicas, algoritmos, orientações e

Leia mais

ESTRUTURA DOS MATERIAIS CERÂMICOS

ESTRUTURA DOS MATERIAIS CERÂMICOS ESTRUTURA DOS MATERIAIS CERÂMICOS Os sólidos são caracterizados por uma associação muito próxima de átomos, em geral representados por esferas rígidas, em contato uns com os outros e mantidos juntos por

Leia mais

TEORIA DO ORBITAL MOLECULAR

TEORIA DO ORBITAL MOLECULAR Teoria do Orbital Molecular - Prof. J. D. Ayala - 1 - TEORIA DO ORBITAL MOLECULAR ORBITAIS NAS MOLÉCULAS A teoria dos orbitais moleculares (MO) constitui uma alternativa para se ter uma visão da ligação.

Leia mais

Introdução a teoria de funcional da densidade (DFT)

Introdução a teoria de funcional da densidade (DFT) Introdução a teoria de funcional da densidade (DFT) uma ferramenta ab-initio para investigação de propriedades atomísticas de materiais XVII ENSEF Prof. Dr. Milan Lalic; Departamento de Física - UFS Processo

Leia mais

Enzimática. Representação termodinâmica da ação catalítica de uma enzima: reação não catalisada. reação enzimaticamente catalisada (+) (o)

Enzimática. Representação termodinâmica da ação catalítica de uma enzima: reação não catalisada. reação enzimaticamente catalisada (+) (o) Cinética Enzimática Representação termodinâmica da ação catalítica de uma enzima: (+) reação não catalisada (o) reação enzimaticamente catalisada 1 Hipótese chave-fechadura Centro ativo complementar em

Leia mais

SIMULAÇÃO COMPUTACIONAL DAS PROPRIEDADES ÓTICAS DO POLIPARAFENILENO

SIMULAÇÃO COMPUTACIONAL DAS PROPRIEDADES ÓTICAS DO POLIPARAFENILENO SIMULAÇÃO COMPUTACIONAL DAS PROPRIEDADES ÓTICAS DO POLIPARAFENILENO Rui Siriano Ribeiro 1 ; Regina Lélis de Sousa 2 ; Nilo Mauricio Sotomayor 3 ; Liliana Yolanda Ancalla Dávila 4 1 Aluno do Curso de Licenciatura

Leia mais

INSTITUTO DE QUÍMICA da UFRJ DEPARTAMENTO DE QUÍMICA INORGÂNICA. Programa de Disciplina. Química Geral EQ. Nome: Código: IQG 115 CARACTERÍSTICAS

INSTITUTO DE QUÍMICA da UFRJ DEPARTAMENTO DE QUÍMICA INORGÂNICA. Programa de Disciplina. Química Geral EQ. Nome: Código: IQG 115 CARACTERÍSTICAS Programa de Disciplina Nome: Química Geral EQ Código: IQG 115 Categoria: Carga Horária Semanal: CARACTERÍSTICAS Número de Semanas Previstas para a Disciplina: 15 Número de Créditos da Disciplina: 4 Pré-Requisito

Leia mais

FATORES QUE AFETAM AS VELOCIDADES DAS REAÇÕES. 2. As concentrações dos reagentes. 3. A temperatura na qual a reação ocorre.

FATORES QUE AFETAM AS VELOCIDADES DAS REAÇÕES. 2. As concentrações dos reagentes. 3. A temperatura na qual a reação ocorre. CINÉTICA QUÍMICA FATORES QUE AFETAM AS VELOCIDADES DAS REAÇÕES 1. O estado físico dos reagentes. 2. As concentrações dos reagentes. 3. A temperatura na qual a reação ocorre. 4. A presença de um catalisador.

Leia mais

Evolução Biológica e Algoritmos Genéticos. Fábio Lima Custódio flc@lncc.br

Evolução Biológica e Algoritmos Genéticos. Fábio Lima Custódio flc@lncc.br Evolução Biológica e Algoritmos Genéticos Fábio Lima Custódio flc@lncc.br Sumário Conceitos gerais O que é evolução? Forças Evolutivas Mutação Deriva Gênica Fluxo gênico Seleção Natural A teoria evolutiva

Leia mais

Universidade Estadual de Maringá/Departamento de Química/Maringá, PR. Química/ Química Orgânica.

Universidade Estadual de Maringá/Departamento de Química/Maringá, PR. Química/ Química Orgânica. EFEIT D SLVENTE N EQUILÍBRI CNFRMACINAL DE CIS-- HALCICLEANÓIS: UM ESTUD TEÓRIC E EPERIMENTAL. Layara Akemi Abiko (IC-Balcão/CNPq-UEM), Rodrigo Meneghuetti Pontes, Ernani Abicht Basso (rientador), e-mail:

Leia mais

Scoring Functions (MolDock Score) Prof. Dr. Walter F. de Azevedo Jr. walter.junior@pucrs.br ou walter.filgueira@hotmail.com

Scoring Functions (MolDock Score) Prof. Dr. Walter F. de Azevedo Jr. walter.junior@pucrs.br ou walter.filgueira@hotmail.com 2015 Dr. Walter F. de Azevedo Jr. Scoring Functions (MolDock Score) Prof. Dr. Walter F. de Azevedo Jr. walter.junior@pucrs.br ou walter.filgueira@hotmail.com 1 O que é desenho de fármacos baseado em computador?

Leia mais

Química Orgânica I Profª Dra. Alceni Augusta Werle Profª Dra.Tânia M. Sacramento Melo

Química Orgânica I Profª Dra. Alceni Augusta Werle Profª Dra.Tânia M. Sacramento Melo Química Orgânica I Profª Dra. Alceni Augusta Werle Profª Dra.Tânia M. Sacramento Melo Ligação Química e Estudo do Átomo de Carbono Aula 1 1- INTRODUÇÃO Os átomos são formados por nêutrons, prótons e elétrons.

Leia mais

OS EFEITOS DA POLARIDADE DAS LIGAÇÕES NAS MOLÉCULAS ORGÂNICAS DOS HALOGENETOS DE ALQUILA

OS EFEITOS DA POLARIDADE DAS LIGAÇÕES NAS MOLÉCULAS ORGÂNICAS DOS HALOGENETOS DE ALQUILA OS EFEITOS DA POLARIDADE DAS LIGAÇÕES NAS MOLÉCULAS ORGÂNICAS DOS HALOGENETOS DE ALQUILA Natalia Soares Quinete Bolsista de Inic. Científica, Eng. Química, UFF Peter Rudolf Seidl Orientador, Químico industrial,

Leia mais

Ácidos e bases. Aula 8 Ácidos e Bases / ph. Par ácido-base conjugado. Ácidos e bases

Ácidos e bases. Aula 8 Ácidos e Bases / ph. Par ácido-base conjugado. Ácidos e bases Aula 8 Ácidos e Bases / ph Prof. Ricardo Aparicio - IQ/Unicamp - 1s/2009 QG107 (Biologia) - 1s/2009 Definição de Brønsted-Lowry (1923) definição mais abrangente que a de Arrhenius ácidos e bases = ácidos

Leia mais

CQ049 : FQ IV - Eletroquímica. CQ049 FQ Eletroquímica. prof. Dr. Marcio Vidotti LEAP Laboratório de Eletroquímica e Polímeros mvidotti@ufpr.

CQ049 : FQ IV - Eletroquímica. CQ049 FQ Eletroquímica. prof. Dr. Marcio Vidotti LEAP Laboratório de Eletroquímica e Polímeros mvidotti@ufpr. CQ049 FQ Eletroquímica prof. Dr. Marcio Vidotti LEAP Laboratório de Eletroquímica e Polímeros mvidotti@ufpr.br 1 a estrutura I-S (água) ion central moléculas de água orientadas interações ion - dipolo

Leia mais

Um dos mais importantes avanços

Um dos mais importantes avanços Carlos Rangel Rodrigues A modelagem molecular é uma ferramenta importante no desenvolvimento de fármacos. Neste trabalho, descrevemos os dois principais métodos empregados na elaboração de programas de

Leia mais

Estrutura tridimensional de proteínas. Prof. Dr. Fernando Berton Zanchi

Estrutura tridimensional de proteínas. Prof. Dr. Fernando Berton Zanchi Estrutura tridimensional de proteínas Prof. Dr. Fernando Berton Zanchi Níveis de Estruturas Protéicas A conformação espacial das proteínas As proteínas não são traços rígidos porque suas ligações químicas

Leia mais

Profa Fernanda Galante Fundamentos de Química e Biologia Molecular/ Nutrição Material 3 1 LIGAÇÕES QUIMICAS

Profa Fernanda Galante Fundamentos de Química e Biologia Molecular/ Nutrição Material 3 1 LIGAÇÕES QUIMICAS Profa Fernanda Galante Fundamentos de Química e Biologia Molecular/ Nutrição Material 3 1 LIGAÇÕES QUIMICAS REGRA DO OCTETO Cada átomo tem um número de elétrons diferente e estes e - (elétrons) estão distribuídos

Leia mais

Ligações Químicas Ligação Iônica Ligação Metálica

Ligações Químicas Ligação Iônica Ligação Metálica Química Geral e Inorgânica QGI0001 Eng a. de Produção e Sistemas Prof a. Dr a. Carla Dalmolin Ligações Químicas Ligação Iônica Ligação Metálica Periodicidade O átomo é visto como uma esfera, onde só as

Leia mais

INTERAÇÃO DOS RAIOS-X COM A MATÉRIA

INTERAÇÃO DOS RAIOS-X COM A MATÉRIA INTERAÇÃO DOS RAIOS-X COM A MATÉRIA RAIOS-X + MATÉRIA CONSEQUÊNCIAS BIOLÓGICAS EFEITOS DAZS RADIAÇÕES NA H2O A molécula da água é a mais abundante em um organismo biológico, a água participa praticamente

Leia mais

ALGORITMO HÍBRIDO PARA SISTEMAS DE RECOMENDAÇÃO UTILIZANDO FILTRAGEM COLABORATIVA E ALGORITMO GENÉTICO

ALGORITMO HÍBRIDO PARA SISTEMAS DE RECOMENDAÇÃO UTILIZANDO FILTRAGEM COLABORATIVA E ALGORITMO GENÉTICO ALGORITMO HÍBRIDO PARA SISTEMAS DE RECOMENDAÇÃO UTILIZANDO FILTRAGEM COLABORATIVA E ALGORITMO GENÉTICO Renan de Oliveira Yamaguti Faculdade de Engenharia de Computação / CEATEC renan.yamaguti@terra.com.br

Leia mais

CENTRO DE EDUCAÇÃO INTEGRADA Educando para o pensar Tema Integrador 2013 / Construindo o amanhã: nós agimos, o planeta sente CONTEÚDOS PROGRAMÁTICOS

CENTRO DE EDUCAÇÃO INTEGRADA Educando para o pensar Tema Integrador 2013 / Construindo o amanhã: nós agimos, o planeta sente CONTEÚDOS PROGRAMÁTICOS CENTRO DE EDUCAÇÃO INTEGRADA Educando para o pensar Tema Integrador 2013 / Construindo o amanhã: nós agimos, o planeta sente BIOLOGIA I TRIMESTRE A descoberta da vida Biologia e ciência Origem da vida

Leia mais

Algoritmos Genéticos

Algoritmos Genéticos UNIVERSIDADE PRESBITERIANA MACKENZIE Laboratório de Computação Natural LCoN I ESCOLA DE COMPUTAÇÃO NATURAL Algoritmos Genéticos Rafael Xavier e Willyan Abilhoa Outubro/2012 www.computacaonatural.com.br

Leia mais

Cristalização e Caracterização Estrutural por Difração de Raios X do composto β-ciclodextrina com um agonista do receptor D2 da dopamina

Cristalização e Caracterização Estrutural por Difração de Raios X do composto β-ciclodextrina com um agonista do receptor D2 da dopamina Cristalização e Caracterização Estrutural por Difração de Raios X do composto β-ciclodextrina com um agonista do receptor D2 da dopamina Rosane de Paula CASTRO, José Ricardo SABINO, Carlos Alberto Mansour

Leia mais

RESOLUÇÃO DA PROVA DE QUÍMICA DA UFRGS 2011

RESOLUÇÃO DA PROVA DE QUÍMICA DA UFRGS 2011 RESOLUÇÃO DA PROVA DE QUÍMICA DA UFRGS 2011 Questão 26 Como a questão pede a separação do sólido solúvel do líquido, o único processo recomendado é a destilação simples. Lembrando que filtração e decantação

Leia mais

Ensino Médio Unidade Parque Atheneu. Professor (a): Me. DIOGO LOPES Aluno (a): Série: 3ª Data: / / 2015. LISTA DE QUÍMICA I

Ensino Médio Unidade Parque Atheneu. Professor (a): Me. DIOGO LOPES Aluno (a): Série: 3ª Data: / / 2015. LISTA DE QUÍMICA I Ensino Médio Unidade Parque Atheneu Professor (a): Me. DIOGO LOPES Aluno (a): Série: 3ª Data: / / 2015. LISTA DE QUÍMICA I OBS: Sua lista semanal deverá ser respondida em folha de papel almaço, copiando

Leia mais

Próton Nêutron Elétron

Próton Nêutron Elétron Próton Nêutron Elétron Próton Nêutron Elétron Número de prótons: 54 2 Nome do elemento: BORO BERÍLIO HÉLIO Esta Os quantidade diferentes tipos de prótons de átomos recebe (elementos o nome químicos) de

Leia mais

LIGAÇÕES QUÍMICAS TEORIA CORPUSCULAR

LIGAÇÕES QUÍMICAS TEORIA CORPUSCULAR LIGAÇÕES QUÍMICAS 5 TEORIA CORPUSCULAR 1 INTRODUÇÃO O fato de os gases nobres existirem na natureza como átomos isolados, levou os cientistas KOSSEL e LEWIS a elaborar um modelo para as ligações químicas.

Leia mais

Universidade Estadual de Goiás Unidade Universitária de Ciências Exatas e Tecnológicas

Universidade Estadual de Goiás Unidade Universitária de Ciências Exatas e Tecnológicas Universidade Estadual de Goiás Unidade Universitária de Ciências Exatas e Tecnológicas Lilian Tatiane Ferreira de Melo Camargo Estudo Químico-Quântico da Relação Estrutura Atividade da Indolo [2,1b] Quinazolina

Leia mais

UFABC Bacharelado em Ciência & Tecnologia

UFABC Bacharelado em Ciência & Tecnologia UFABC Bacharelado em Ciência & Tecnologia Transformações Bioquímicas (BC0308) Prof Luciano Puzer http://professor.ufabc.edu.br/~luciano.puzer/ Energia de interação entre macromoléculas Interações em meio

Leia mais

Estudo Teórico de Complexos Moleculares Contidos no Biogás

Estudo Teórico de Complexos Moleculares Contidos no Biogás SIMPOETS, CEFET-GO, 131-138, 2008 Estudo Teórico de Complexos Moleculares Contidos no Biogás Jaqueline Teixeira Ramos 1 Graduanda de Licenciatura em Química jaquelineramos.quimica@hotmail.com Simone Souza

Leia mais

DEPENDÊNCIA DA VELOCIDADE COM A TEMPERATURA Camilo Andrea Angelucci

DEPENDÊNCIA DA VELOCIDADE COM A TEMPERATURA Camilo Andrea Angelucci DPNDÊNCIA DA VLOCIDAD COM A TMPRATURA Camilo Andrea Angelucci MTA Apresentar os conceitos da infl uência da temperatura na velocidade das reações químicas. OBJTIVOS Ao fi nal desta aula, o aluno deverá:

Leia mais

ANO LETIVO 2014 / 2015

ANO LETIVO 2014 / 2015 ANO LETIVO 2014 / 2015 INTRODUÇÃO Os conteúdos exigidos nas provas de acesso aos cursos ministrados no Instituto Superior de Ciências da Saúde Egas Moniz (ISCSEM) estão contemplados nos programas oficiais

Leia mais

Configurações eletrônicas

Configurações eletrônicas Configurações eletrônicas Metais de transição Depois de Ar, os orbitais d começam a ser preenchidos. Depois que os orbitais 3d estiverem preenchidos, os orbitais 4p começam a ser preenchidos. Metais de

Leia mais

-2014- CONTEÚDO SEPARADO POR TRIMESTRE E POR AVALIAÇÃO CIÊNCIAS 9º ANO 1º TRIMESTRE

-2014- CONTEÚDO SEPARADO POR TRIMESTRE E POR AVALIAÇÃO CIÊNCIAS 9º ANO 1º TRIMESTRE -2014- CONTEÚDO SEPARADO POR TRIMESTRE E POR AVALIAÇÃO CIÊNCIAS 9º ANO 1º TRIMESTRE DISCURSIVA OBJETIVA QUÍMICA FÍSICA QUÍMICA FÍSICA Matéria e energia Propriedades da matéria Mudanças de estado físico

Leia mais

Arquitetura de domínios proteícos

Arquitetura de domínios proteícos Bioinformática Osmar NORBERTO DE SOUZA, PhD E-mail: osmar.norberto@pucrs.br Laboratório de Bioinformática, Modelagem e Simulação de Biossistemas - LABIO Faculdade de Informática Pontifícia Universidade

Leia mais

3 ALGORITMOS GENÉTICOS : CONCEITOS BÁSICOS E EXTENSÕES VINCULADAS AO PROBLEMA DE MINIMIZAÇÃO DE PERDAS

3 ALGORITMOS GENÉTICOS : CONCEITOS BÁSICOS E EXTENSÕES VINCULADAS AO PROBLEMA DE MINIMIZAÇÃO DE PERDAS 3 ALGORITMOS GENÉTICOS : CONCEITOS BÁSICOS E EXTENSÕES VINCULADAS AO PROBLEMA DE MINIMIZAÇÃO DE PERDAS 3.1 - Conceitos Básicos Entendemos como algoritmo um conjunto predeterminado e bem definido de regras

Leia mais

PROVA ESPECIALMENTE ADEQUADA DESTINADA A AVALIAR A CAPACIDADE PARA A FREQUÊNCIA DO ENSINO SUPERIOR DOS MAIORES DE 23 ANOS PROVA DE QUÍMICA

PROVA ESPECIALMENTE ADEQUADA DESTINADA A AVALIAR A CAPACIDADE PARA A FREQUÊNCIA DO ENSINO SUPERIOR DOS MAIORES DE 23 ANOS PROVA DE QUÍMICA PROVA ESPECIALMENTE ADEQUADA DESTINADA A AVALIAR A CAPACIDADE PARA A FREQUÊNCIA DO ENSINO SUPERIOR DOS MAIORES DE 23 ANOS PROVA DE QUÍMICA TEMAS 1. Estrutura da matéria 1.1 Elementos, átomos e iões 1.2

Leia mais

Conexões entre matemática e biologia

Conexões entre matemática e biologia EB-207 Matemática Biológica 1 Conexões entre matemática e biologia Prof. Rodrigo Sávio Pessoa Sumário 2 1. Introdução 2. A nanotecnologia aplicada as ciências biológicas 3. Algumas questões biológicas

Leia mais

CLASSIFICAÇÃO PERIÓDICA DOS ELEMENTOS

CLASSIFICAÇÃO PERIÓDICA DOS ELEMENTOS 1 1 1 H 1, 00 2 3 4 2 Li 6, 94 Be 9, 01 11 12 3 Na Mg 22, 99 24, 31 19 20 4 K 39, 10 Ca 40, 08 37 38 5 Rb Sr 85, 47 87, 62 55 56 6 Cs 132, 91 Ba 137, 33 87 88 7 Fr Ra 223, 02 226, 03 CLASSIFICAÇÃO PERIÓDICA

Leia mais

Práticas de Físico Química QB75B. Experimento 7

Práticas de Físico Química QB75B. Experimento 7 1 PR UNIVERSIDADE TECNOLÓGICA EDERAL DO PARANÁ MINISTÉRIO DA EDUCAÇÃO UNIVERSIDADE TECNOLÓGICA EDERAL DO PARANÁ - UTPR DEPARTAMENTO ACADÊMICO DE QUÍMICA E BIOLOGIA BACHARELADO EM QUÍMICA Práticas de ísico

Leia mais

22/Abr/2015 Aula 15. 17/Abr/2015 Aula 14

22/Abr/2015 Aula 15. 17/Abr/2015 Aula 14 17/Abr/2015 Aula 14 Introdução à Física Quântica Radiação do corpo negro; níveis discretos de energia. Efeito foto-eléctrico: - descrições clássica e quântica - experimental. Efeito de Compton. 22/Abr/2015

Leia mais

A Iniciativa de P&D da Empresa X

A Iniciativa de P&D da Empresa X Projetos 1. Eliezer Barreiro Fármacos antinflamatórios 2. Valdir Cechinel Filho Hiperplasia Benigna da Próstata- fitoterápico 3. Valdir Cechinel Filho Analgésico - fitoterápico 4. Sérgio T. Ferreira Doença

Leia mais

Aula 6. Organic Chemistry. Reações de Substituição em Haletos de Alquila. O que é uma reação de substituição?

Aula 6. Organic Chemistry. Reações de Substituição em Haletos de Alquila. O que é uma reação de substituição? Organic Chemistry 4 th Edition Paula Yurkanis Bruice Aula 6 Reações de Substituição em Haletos de Alquila Irene Lee Case Western Reserve University Cleveland, OH 2004, Prentice Hall O que é uma reação

Leia mais

GEOMETRIA MOLECULAR E INTERAÇÕES QUÍMICAS MOLECULARES. Professor Cristiano

GEOMETRIA MOLECULAR E INTERAÇÕES QUÍMICAS MOLECULARES. Professor Cristiano GEOMETRIA MOLECULAR E INTERAÇÕES QUÍMICAS MOLECULARES Professor Cristiano GEOMETRIA MOLECULAR É o estudo de como os átomos estão distribuídos espacialmente em uma molécula. Dependendo dos átomos que a

Leia mais

QUÍMICA. Questão 31. Questão 32

QUÍMICA. Questão 31. Questão 32 QUÍMICA Questão 3 Em 9,9 g de um sal de cálcio encontra-se 0,5 mol desse elemento. Qual a massa molar do ânion trivalente que forma esse sal? Dado: Ca 40 g/mol. (A) 39 g/mol. (B) 278 g/mol. (C) 63,3 g/mol.

Leia mais

PROFESSOR LOURIVAL NETO

PROFESSOR LOURIVAL NETO QUÍMICA EM 1 DIA PROFESSOR LOURIVAL NETO UBERLÂNDIA LIGAÇÕES QUÍMICAS Iônica: Ocorre devido a transferência de elétrons! Ìons mantêmse em um cristal Retículo cristalino. A força eletrostática mantém os

Leia mais

EQUILÍBRIO QUÍMICO 1

EQUILÍBRIO QUÍMICO 1 EQUILÍBRIO QUÍMICO 1 1- Introdução Uma reação química é composta de duas partes separadas por uma flecha, a qual indica o sentido da reação. As espécies químicas denominadas como reagentes ficam à esquerda

Leia mais

IBM1018 Física Básica II FFCLRP USP Prof. Antônio Roque Aula 3

IBM1018 Física Básica II FFCLRP USP Prof. Antônio Roque Aula 3 Linhas de Força Mencionamos na aula passada que o físico inglês Michael Faraday (79-867) introduziu o conceito de linha de força para visualizar a interação elétrica entre duas cargas. Para Faraday, as

Leia mais

Otimização da Flexão em Estruturas de Aço com Ligações Semi- Rígidas através de Algoritmos Genéticos

Otimização da Flexão em Estruturas de Aço com Ligações Semi- Rígidas através de Algoritmos Genéticos Otimização da Flexão em Estruturas de Aço com Ligações Semi- Rígidas através de Algoritmos Genéticos Alexandre A. Del Savio, arco Aurélio C. Pacheco 2, Sebastião A. L. de Andrade, Pedro C. G. da S. Vellasco

Leia mais

Centro de Educação Integrada

Centro de Educação Integrada Centro de Educação Integrada 1º ANO BIOLOGIA Origem da vida Citologia Teoria da geração espontânea e biogênese. Teoria de Oparin e Haldane. Panspermia. Criacionismo. Os primeiros seres vivos. Água. Sais

Leia mais

ESTEREOQUIMICA ELEMENTOS DE SIMETRIA

ESTEREOQUIMICA ELEMENTOS DE SIMETRIA ESTEREOQUIMIA 1 Prof. ugo Braibante ELEMENTOS DE SIMETRIA Simetria, uma ferramenta matemática e ao mesmo tempo um índice estético, é um meio privilegiado de descobrir algumas belezas da ciência, pois nos

Leia mais

01) (ACAFE) O grupo de átomos que é encontrado na forma monoatômica pelo fato de serem estáveis é:

01) (ACAFE) O grupo de átomos que é encontrado na forma monoatômica pelo fato de serem estáveis é: 01) (ACAFE) O grupo de átomos que é encontrado na forma monoatômica pelo fato de serem estáveis é: a) Halogênios b) Calcogênios c) Metais Alcalinos Terrosos d) Metais Alcalinos e) Gases Nobres 02) (UFF-RJ)

Leia mais

Ivonildo Almeida dos Santos 1 ; Manoelito Coelho dos Santos Junior 2. PALAVRAS-CHAVE:vassoura-de-bruxa,pirofosforilase,M. perniciosa.

Ivonildo Almeida dos Santos 1 ; Manoelito Coelho dos Santos Junior 2. PALAVRAS-CHAVE:vassoura-de-bruxa,pirofosforilase,M. perniciosa. 1306 DESENVOLVIMENTO DE UM BANCO DE DADOS COM ESTRUTURAS QUÍMICAS DERIVADAS DO SEMI-ÁRIDO BAIANO, PARA PESQUISA DE POSSÍVEIS INIBIDORES DA ENZIMA DO FUNGOMONILIOPHTHORA PERNICIOSA TRIAGEM VIRTUAL Ivonildo

Leia mais

MINISTÉRIO DA EDUCAÇÃO E DO DESPORTO CENTRO FEDERAL DE EDUCAÇÃO TECNOLÓGICA CELSO SUCKOW DA FONSECA

MINISTÉRIO DA EDUCAÇÃO E DO DESPORTO CENTRO FEDERAL DE EDUCAÇÃO TECNOLÓGICA CELSO SUCKOW DA FONSECA MINISTÉRIO DA EDUCAÇÃO E DO DESPORTO SECRETARIA DA EDUCAÇÃO SUPERIOR CENTRO FEDERAL DE EDUCAÇÃO TECNOLÓGICA CELSO SUCKOW DA FONSECA CURSO DE ENGENHARIA INDUSTRIAL DEPARTAMENTO DEPBG PLANO DE CURSO DA DISCIPLINA

Leia mais

DESENVOLVIMENTO DE AMBIENTES VIRTUAIS PARA O ENSINO DA FÍSICA

DESENVOLVIMENTO DE AMBIENTES VIRTUAIS PARA O ENSINO DA FÍSICA DESENVOLVIMENTO DE AMBIENTES VIRTUAIS PARA O ENSINO DA FÍSICA TRINDADE, Jorge Fonseca Escola Superior de Tecnologia e Gestão Instituto Politécnico da Guarda Guarda, Portugal FIOLHAIS, Carlos Departamento

Leia mais

CAPÍTULO III LIGAÇÕES QUÍMICAS

CAPÍTULO III LIGAÇÕES QUÍMICAS CAPÍTULO III LIGAÇÕES QUÍMICAS LIGAÇÕES QUÍMICAS 3.1. Introdução As propriedades dos átomos são determinadas pela carga nuclear (número atômico) e pela forma como os elétrons estão distribuídos ao redor

Leia mais

COLÉGIO SANTA TERESINHA R. Madre Beatriz 135 centro Tel. (33) 3341-1244 www.colegiosantateresinha.com.br

COLÉGIO SANTA TERESINHA R. Madre Beatriz 135 centro Tel. (33) 3341-1244 www.colegiosantateresinha.com.br PLANEJAMENTO DE AÇÕES DA 2 ª ETAPA 2015 PERÍODO DA ETAPA: 01/09/2015 á 04/12/2015 TURMA: 9º Ano EF II DISCIPLINA: CIÊNCIAS / QUÍMICA 1- S QUE SERÃO TRABALHADOS DURANTE A ETAPA : Interações elétricas e

Leia mais

Próton Nêutron Elétron

Próton Nêutron Elétron Próton Nêutron Elétron ARNOLD SOMMERFELD MODELO ATÔMICO DE ARNOLD SOMMERFELD - 1916 Ao pesquisar o átomo, Sommerfeld concluiu que os elétrons de um mesmo nível, ocupam órbitas de trajetórias diferentes

Leia mais

Propriedades Estruturais e Ação dos Fármacos

Propriedades Estruturais e Ação dos Fármacos Ministério da Educação UIVERSIDADE FEDERAL D PARAÁ Setor de Ciências da Saúde Departamento de Farmácia Disciplina de Química Medicinal Farmacêutica Propriedades Estruturais e Ação dos Fármacos Introdução

Leia mais

UNIVERSIDADE FEDERAL DE PELOTAS CURSO de LICENCIATURA em QUÍMICA Disciplina: Didática da Química Profª Maira Ferreira

UNIVERSIDADE FEDERAL DE PELOTAS CURSO de LICENCIATURA em QUÍMICA Disciplina: Didática da Química Profª Maira Ferreira UNIVERSIDADE FEDERAL DE PELOTAS CURSO de LICENCIATURA em QUÍMICA Disciplina: Didática da Química Profª Maira Ferreira MODELOS DE LIGAÇÕES QUÍMICAS E PROPRIEDADES FÍSICAS DAS SUBSTÂNCIAS 1 Os conceitos

Leia mais

Cinética Química. Professora (Estagiária): Magda Vieira Professora Supervisora: Kátia Aquino. Profa. Kátia Aquino

Cinética Química. Professora (Estagiária): Magda Vieira Professora Supervisora: Kátia Aquino. Profa. Kátia Aquino Cinética Química Professora (Estagiária): Magda Vieira Professora Supervisora: Kátia Aquino Profa. Kátia Aquino 1 As reações também possuem suas velocidades próprias Muito rápida: combustão http://www.franciscoevangelista.com/2012/07/incendio-residencial-com-vitima-fatal.html

Leia mais

A estrutura eletrônica de moléculas, sólidos e superfícies

A estrutura eletrônica de moléculas, sólidos e superfícies OUT. NOV. DEZ. 2007 ANO XIII, Nº 52 363-369 INTEGRAÇÃO 363 A estrutura eletrônica de moléculas, sólidos e superfícies DOUGLAS CASAGRANDE Resumo Neste trabalho são abordados alguns aspectos da teoria de

Leia mais

Bioinformática Histórico e conceitos básicos

Bioinformática Histórico e conceitos básicos Bioinformática Histórico e conceitos básicos Raimundo Lima da S. Júnior M.Sc. Departamento de Biologia Núcleo de Pesquisas Replicon PUC-GO Silva Jr., RL Casamento entre a ciência da computação e a biologia

Leia mais

objetivo Exercícios Meta da aula Pré-requisitos Aplicar o formalismo quântico estudado neste módulo à resolução de um conjunto de exercícios.

objetivo Exercícios Meta da aula Pré-requisitos Aplicar o formalismo quântico estudado neste módulo à resolução de um conjunto de exercícios. Exercícios A U L A 10 Meta da aula Aplicar o formalismo quântico estudado neste módulo à resolução de um conjunto de exercícios. objetivo aplicar os conhecimentos adquiridos nas Aulas 4 a 9 por meio da

Leia mais

- LIGAÇÕES IÔNICAS: Na (1s 2 2s 2 2p 6 3s 1 ) + Cl (1s 2 2s 2 2p 6 3s 2 3p 5 ) Na + (1s 2 2s 2 2p 6 ) + Cl - (1s 2 2s 2 2p 6 3s 2 3p 6 )

- LIGAÇÕES IÔNICAS: Na (1s 2 2s 2 2p 6 3s 1 ) + Cl (1s 2 2s 2 2p 6 3s 2 3p 5 ) Na + (1s 2 2s 2 2p 6 ) + Cl - (1s 2 2s 2 2p 6 3s 2 3p 6 ) - LIGAÇÕES IÔNICAS: A ligação iônica é a ligação química formada pela atração eletrostática entre íons positivos e íons negativos. A ligação se dá entre dois átomos quando um elétron, ou mais um, se transfere

Leia mais

Forças intermoleculares, Disciplina de Química Geral Profa. Marcia Margarete Meier

Forças intermoleculares, Disciplina de Química Geral Profa. Marcia Margarete Meier , líquidos e sólidos 1 Uma comparação entre líquidos e sólidos As propriedades físicas das substâncias entendidas em termos de teoria cinética molecular : Os gases são altamente compressíveis, assumem

Leia mais

DETERMINAÇÃO DA ESTRUTURA TRIDIMENSIONAL DE PROTEÍNAS POR DIFRAÇÃO DE RAIOS-X

DETERMINAÇÃO DA ESTRUTURA TRIDIMENSIONAL DE PROTEÍNAS POR DIFRAÇÃO DE RAIOS-X DETERMINAÇÃO DA ESTRUTURA TRIDIMENSIONAL DE PROTEÍNAS POR DIFRAÇÃO DE RAIOS-X Disciplina: Engenharia de Proteínas Ma. Flávia Campos Freitas Vieira NÍVEIS ESTRUTURAIS DAS PROTEÍNAS Fonte: Lehninger, 2010.

Leia mais

a) Qual a configuração eletrônica do cátion do alumínio isoeletrônico ao gás nobre neônio?

a) Qual a configuração eletrônica do cátion do alumínio isoeletrônico ao gás nobre neônio? Questão 1: O Brasil é o campeão mundial da reciclagem de alumínio, colaborando com a preservação do meio ambiente. Por outro lado, a obtenção industrial do alumínio sempre foi um processo caro, consumindo

Leia mais

QUÍMICA FARMACÊUTICA I

QUÍMICA FARMACÊUTICA I PROTÓTIPO QUÍMICA FARMACÊUTICA I AULA 5 Primeiro tipo ou exemplar original, modelo. Diz-se do composto originalmente identificado que apresenta atividade farmacológica in vivo. Profa. Ms. Paula Cristina

Leia mais

AGRUPAMENTO de ESCOLAS Nº1 de SANTIAGO do CACÉM Ano Letivo 2013/2014 PLANIFICAÇÃO ANUAL

AGRUPAMENTO de ESCOLAS Nº1 de SANTIAGO do CACÉM Ano Letivo 2013/2014 PLANIFICAÇÃO ANUAL AGRUPAMENTO de ESCOLAS Nº1 de SANTIAGO do CACÉM Ano Letivo 2013/2014 PLANIFICAÇÃO ANUAL Documento(s) Orientador(es): Programa Física e Química A 10º Ano ENSINO SECUNDÁRIO FÍSICA E QUÍMICA A 10º ANO TEMAS/DOMÍNIOS

Leia mais

UNIDADE 3 - COORDENAÇÃO ATÔMICA

UNIDADE 3 - COORDENAÇÃO ATÔMICA A força de repulsão entre os elétrons de dois átomos, quando estão suficientemente próximos, é responsável, em conjunto com as forças de atração, pela posição de equilíbrio dos átomos na ligação química

Leia mais

A força está com você.

A força está com você. Revista eletrônica do Departamento de Química - UFSC FLORIANÓPOLIS Química - UFSC QMCWEB: Ano 4 O que mantém as moléculas unidas nos estados líquido e sólido? Que força faz a água, contrariando a gravidade,

Leia mais

As membranas são os contornos das células, compostos por uma bicamada lipídica

As membranas são os contornos das células, compostos por uma bicamada lipídica Células e Membranas As membranas são os contornos das células, compostos por uma bicamada lipídica Organelas são compartimentos celulares limitados por membranas A membrana plasmática é por si só uma organela.

Leia mais

UFMG - 2004 3º DIA QUÍMICA BERNOULLI COLÉGIO E PRÉ-VESTIBULAR

UFMG - 2004 3º DIA QUÍMICA BERNOULLI COLÉGIO E PRÉ-VESTIBULAR UFMG - 2004 3º DIA QUÍMICA BERNOULLI COLÉGIO E PRÉ-VESTIBULAR Química Questão 01 Os metais alcalinos, ao reagirem com água, produzem soluções dos respectivos hidróxidos e gás hidrogênio. Esta tabela apresenta

Leia mais

Explorando bancos de dados genômicos e introdução à bioinformática. Guilherme Targino Valente Marcos Tadeu Geraldo. Bioinformática

Explorando bancos de dados genômicos e introdução à bioinformática. Guilherme Targino Valente Marcos Tadeu Geraldo. Bioinformática Explorando bancos de dados genômicos e introdução à bioinformática Guilherme Targino Valente Marcos Tadeu Geraldo 22/07/2011 Bioinformática É a aplicação de estatística e ciência da computação no campo

Leia mais

Computação BioInspirada

Computação BioInspirada Computação BioInspirada Os Engenheiros da Natureza Fabrício Olivetti de França The reasonable man adapts himself to the world; the unreasonable one persists in trying to adapt the world to himself. Therefore

Leia mais

Introdução. Princípios da corrosão: reações de oxiredução potencial de eletrodo - sistema redox em equilíbrio - Diagrama de Pourbaix

Introdução. Princípios da corrosão: reações de oxiredução potencial de eletrodo - sistema redox em equilíbrio - Diagrama de Pourbaix Introdução Princípios da corrosão: reações de oxiredução potencial de eletrodo - sistema redox em equilíbrio - Diagrama de Pourbaix Introdução Conceitos de oxidação e redução 1 - Ganho ou perda de oxigênio

Leia mais

V SBQEE COMPORTAMENTO DE GERADORES SÍNCRONOS TRIFÁSICOS ALIMENTANDO CARGAS NÃO LINEARES E DESEQUILIBRADAS. UMA ABORDAGEM ANALÍTICA E EXPERIMENTAL

V SBQEE COMPORTAMENTO DE GERADORES SÍNCRONOS TRIFÁSICOS ALIMENTANDO CARGAS NÃO LINEARES E DESEQUILIBRADAS. UMA ABORDAGEM ANALÍTICA E EXPERIMENTAL V SBQEE Seminário Brasileiro sobre Qualidade da Energia Elétrica 17 a 20 de Agosto de 2003 Aracaju Sergipe Brasil Código: AJU 03 091 Tópico: Modelagens e Simulações COMPORTAMENTO DE GERADORES SÍNCRONOS

Leia mais

PROVA DE QUÍMICA - 1998 Segunda Etapa

PROVA DE QUÍMICA - 1998 Segunda Etapa PROVA DE QUÍMICA - 1998 Segunda Etapa QUESTÃO 01 Num laboratório químico, havia três frascos que continham, respectivamente, um alcano, um álcool e um alqueno. Foram realizados experimentos que envolviam

Leia mais

Enzimas. Profª Eleonora Slide de aula

Enzimas. Profª Eleonora Slide de aula Enzimas Profª Eleonora Slide de aula Enzimas São proteínas capazes de promover catálise de reações biológicas. Possuem alta especificidade e grande poder catalítico. Especificidade: o substrato sofre ação

Leia mais

Olimpíada Brasileira de Química

Olimpíada Brasileira de Química Programa Nacional Olimpíadas de Química SOLUÇÕES ESCOLHIDAS Olimpíada asileira de Química Questão 11 - Resolução apresentada pelo estudante Guilherme Eiichi da Silva - Colégio Objetivo Luís Góes - SP.

Leia mais

Prof. João Maria Soares UERN/DF/Mossoró E-mail: joaomsoares@gmail.com

Prof. João Maria Soares UERN/DF/Mossoró E-mail: joaomsoares@gmail.com Prof. João Maria Soares UERN/DF/Mossoró E-mail: joaomsoares@gmail.com 1. Estrutura cristalina redes de Bravais 2. Principais estruturas cristalinas 3. Sistemas cristalinos 4. Simetria e grupos de simetria

Leia mais

Quando esses temas são compreendidos, o aprendizado da química orgânica se torna muito mais fácil, diminuindo a necessidade de memorização.

Quando esses temas são compreendidos, o aprendizado da química orgânica se torna muito mais fácil, diminuindo a necessidade de memorização. REAÇÕES ORGÂNIAS A primeira vista, a química orgânica pode ser observada como uma coleção confusa de milhões de compostos, dezenas de grupos funcionais e um número infinito de reações químicas. Ao estudá-la,

Leia mais

Lista de Exercício de Química - N o 6

Lista de Exercício de Química - N o 6 Lista de Exercício de Química - N o 6 Profa. Marcia Margarete Meier 1) Arranje em ordem crescente de energia, os seguintes tipos de fótons de radiação eletromagnética: raios X, luz visível, radiação ultravioleta,

Leia mais

ÁCIDOS E BASES. + (aq) + OH - (aq)

ÁCIDOS E BASES. + (aq) + OH - (aq) ÁCIDOS E BASES O conhecimento sobre termodinâmica, particularmente sobre as constantes de equilíbrio é de grande importância na discussão quantitativa das forças de ácidos e bases o que permite desenvolver

Leia mais

QUIMICA ORGÂNICA BÁSICA

QUIMICA ORGÂNICA BÁSICA QUIMICA ORGÂNICA BÁSICA Hibridização Revisão - Química Orgânica Básica 1 Tabela Periódica 2 Moléculas Diatômicas 3 Moléculas Poliatômicas 4 Eletronegatividade 5 A interação da luz e a matéria 6 Hibridização

Leia mais

Propriedades volumétricas de fluidos puros

Propriedades volumétricas de fluidos puros Propriedades volumétricas de fluidos puros Objetivos Compreender o comportamento PVT de fluidos puros Estudar equações de estado para descrever o comportamento PVT de fluidos reais Equações do tipo virial

Leia mais

4 Orbitais do Átomo de Hidrogênio

4 Orbitais do Átomo de Hidrogênio 4 Orbitais do Átomo de Hidrogênio A aplicação mais intuitiva e que foi a motivação inicial para desenvolver essa técnica é a representação dos orbitais do átomo de hidrogênio que, desde então, tem servido

Leia mais

Separação e Cromatografia de Proteínas

Separação e Cromatografia de Proteínas QBQ0316N: Bioquímica Experimental Farmácia São Paulo, 11 de setembro 2013 Separação e Cromatografia de Proteínas Universidade de São Paulo QBQ0316N: Bioquímica Experimental Farmácia São Paulo, 11 de setembro

Leia mais

Propriedades Físicas de alguns compostos

Propriedades Físicas de alguns compostos Propriedades Físicas de alguns compostos Tipo de ligação e temperatura de fusão COMPOSTO Tipo de ligação T fusão / o C NaCl iónica 801 Cu metálica 1083 Si covalente 1410 H 2 O intermolecular 0 C 6 H 6

Leia mais