Métodos de Codificação de Proteínas para Uso com Redes Neurais Artificiais

Tamanho: px
Começar a partir da página:

Download "Métodos de Codificação de Proteínas para Uso com Redes Neurais Artificiais"

Transcrição

1 Métodos de Codificação de Proteínas para Uso com Redes Neurais Artificiais André Luis Debiaso Rossi 1, Maria Angélica de Oliveira Camargo Brunetto 2 1,2 Departamento de Computação, Universidade Estadual de Londrina (UEL), Brasil Resumo - A classificação de proteínas é uma tarefa que requer alto custo computacional. Diferentes métodos são utilizados para esta classificação, sendo um deles as Redes Neurais Artificiais. Para uso desta abordagem é necessário a codificação do alfabeto representando os aminoácidos em valores numéricos. Nesse contexto, esse trabalho tem como objetivo analisar dois diferentes métodos de codificação: usando uma função hashing denominada n-gram e outro usando uma escala de hidrofobicidade dos aminoácidos. Os métodos foram implementados e testados para várias proteínas do banco de dados PDB e pode-se observar que o método usando n-gram tem maior custo computacional, porém é o método que obteve melhores resultados na literatura e pode ser adaptado para diferentes valores de n a serem testados na tarefa de classificação. Palavras-chave: codificação, classificação de proteínas, n-gram, hidrofobicidade. Abstract - Protein classification is a task that requires high computational cost. Among the different ways to perform such classification, there are those based on Artificial Neural Networks. Using this approach requires codifying the alphabet that represents the amino acids in numerical values. In this context, this work aims to analyze two different codification methods: using a hashing function named n-gram and other using an amino acids hydrofobicity scale. The methods have been implemented and tested for several proteins from the PDB database and it was observed that the method using n-gram presents a higher computational cost, however it's the method which obtained better results in literature and can be adapted for different values of n to be tested on the classification task. Key-words: codification, protein classification, n-gram, hydrofobicity. Introdução Os esforços despendidos no seqüenciamento de diversos organismos proporcionaram o surgimento, em ritmo acelerado, de enormes bancos de dados biológicos, principalmente de DNA, RNA e proteínas. Um fator importante no projeto genômico é a mineração desses dados para a obtenção de maiores informações sobre esses organismos. A bioinformática se tornou essencial no objetivo de manipular esses dados a fim de extrair conhecimento, tornando possível a criação de novos medicamentos e tratamentos de doenças genéticas [1], [2] e [3]. Em se tratando de proteínas, há nos bancos de dados públicos um enorme número de seqüências. Cada proteína é formada por seqüências de aminoácidos, sendo estes representados por um alfabeto composto de 20 letras [4]. Diversos modos de classificação estão sendo realizados para facilitar o entendimento e a análise destas proteínas, sendo as redes neurais artificiais uma abordagem utilizada para esse propósito. Dentre outras abordagens conhecidas podemos citar as ferramentas de alinhamento, como a BLAST (Basic Local Align Search Tool) [5], as cadeias ocultas de Markov (Hidden Markov Models - HMM) [6] e os algoritmos genéticos. Alguns estudos realizados por Wu et al (1996) com redes neurais e programas clássicos utilizados em bioinformática, como é o caso do BLAST, obtiveram taxas de exatidão muito próximas, porém o desempenho das redes neurais é muito superior, devido ao fato do tempo de processamento não estar confinado ao tamanho das seqüências. Para utilizar as redes neurais como abordagem de classificação de proteínas, é necessário realizar a codificação do alfabeto que representa os aminoácidos em valores numéricos, pelo fato das redes aceitarem apenas variáveis numéricas como dados de entrada. Métodos de Codificação O método de codificação constitui uma das

2 principais fases para que se obtenha alta taxa de exatidão e um melhor desempenho da rede neural durante o processo de classificação [8]. É possível observar através da literatura avanços na taxa de exatidão devido a diferenças no esquema de codificação utilizado. As seqüências de aminoácidos podem ser interpretadas de diferentes formas, de acordo com um sentido biológico ou pela sua própria seqüência linear, e a partir dessa interpretação os dados são codificados. Nos trabalhos apresentados em [1] e [8], é utilizado um tipo de função hashing denominada n-gram nas seguintes interpretações das seqüências: a) grupo de troca; b) grupo estrutural; c) grupo de hidrofobicidade; além da seqüência linear de aminoácidos. Em Wu et al. (1996) também é utilizado n-grams em motifs ( motivos ) de proteínas [7]. Os motivos ou simplesmente dobras, são arranjos particularmente estáveis de diversos elementos de estrutura secundária e das conexões entre eles [4]. O grupo de troca refere-se a aminoácidos que podem ser substituídos por outros aminoácidos sem alterar a estrutura protéica. O grupo estrutural refere-se a grupos de proteínas que mantém as mesmas similaridades estruturais e o grupo de hidrofobicidade indica as proteínas que mantém um grau de repulsão à água semelhantes. Os n-grams possuem a vantagem de permitir que o tamanho da seqüência apresentada à rede não varie e torna possível a classificação baseada na localização de regiões de similaridade das proteínas [8]. Os n-grams de uma forma simples é uma maneira de representar uma cadeia longa de string em muitas substrings de tamanho n. Os n-grams, segundo Mahleko, Wombacher e Fankhauser (2005), são utilizados com os seguintes objetivos gerais: a) minimizar o tempo de processamento; b) garantir a não ocorrência dos falsos negativos; c) minimizar o número de falsos positivos. Essa função tem sido utilizada na indexação de textos, em particular para substring matching [9]. Utilizando-se, por exemplo, bigram (2-gram) para extração da string ABCDEFGHIJ, teríamos como resultado as seguintes substrings: AB, BC, CD, DE, EF, FG, GH, HI, IJ. Um projeto para classificação de proteínas utilizando redes neurais está sendo desenvolvido no laboratório de pesquisa PROTEM do Departamento de Computação da Universidade Estadual de Londrina, que mantém grupos de pesquisa em informática na saúde. Esse projeto pode ser dividido de forma genérica em três etapas: a) préprocessamento dos dados de entrada; b) implementação, treinamento e teste da rede; c) pósprocessamento dos resultados obtidos. Este artigo descreve a primeira etapa, ou seja, o préprocessamento dos dados de entrada. Metodologia Inicialmente realizou-se um estudo da literatura de diversos métodos de codificação utilizados no processo de classificação de proteínas usando redes neurais. Serviram como base para a codificação das seqüências de aminoácidos os trabalhos de [1], [2] e [8], que utilizaram o método de extração n-gram ([1] e [8]) e a escala de hidrofobicidade ([1], [2] e [8]) para as seqüências de aminoácidos. A implementação do processo de codificação utilizando n-grams pode ser dividido nas seguintes etapas: 1) Obtenção das seqüências de aminoácidos no formato FASTA (FAST-All); 2) Leitura dos arquivos FASTA e união das cadeias das seqüências; 3) Extração da seqüência e contagem de freqüência dos aminoácidos; 4) Montagem da matriz de entrada da rede, contendo todos os possíveis n-grams (para o n escolhido). A etapa 1 consistiu em obter as seqüências de resíduos de aminoácidos por meio do repositório de proteínas do site PDB 1 (Protein Data Bank). Foram obtidas amostras de cinco diferentes grupos funcionais (hydrolase(o.g.), immunoglobulin, lyase, oxygen transport e toxin) e 100 proteínas de cada grupo funcional, perfazendo um total de 500 proteínas. Cada grupo constituiu um arquivo no formato FASTA. Um exemplo deste formato é mostrado na Figura 1. >1ABT:A PDBID CHAIN SEQUENCE IVCHTTATSPISAVTCPPGENLCYRKMWCDAFCS SRGKVVELGCAATCPSKKPYEEVTCCSTDKCNPH PKQRPG >1ABT:B PDBID CHAIN SEQUENCE KHWVYYTCCPDT Figura 1 Arquivo FASTA da proteína de identificação 1ABT, extraída do banco de dados PDB Essa seqüência refere-se à proteína de identificação 1ABT no site PDB que é formada por duas cadeias, A e B, sendo a cadeia A formada por 74 aminoácidos e a cadeia B por 12 aminoácidos. Para a realização da etapa 2 foi utilizada a linguagem de programação Java e a classe biojava

3 para auxiliar no processo de leitura do arquivo FASTA. Esta classe provê um framework para processamento de dados biológicos para a linguagem Java, incluindo objetos para manipulação de seqüências biológicas, ferramentas para fazer GUIs 3 para análise de seqüências, além de rotinas estatísticas e outras. As proteínas estavam separadas em cadeias de seqüência, como visto no exemplo de um trecho do arquivo FASTA mostrado anteriormente, que foram concatenadas formando apenas uma seqüência e posteriormente gravada em um novo arquivo com os resíduos de aminoácidos na forma abreviada, utilizando três letras para cada aminoácido. A extração e contagem da freqüência usando 2-gram foi realizada por meio de um conjunto de programas em Perl denominado NSP 4 (Ngram Statistics Package), que permite identificar n-grams em textos. O único programa utilizado desse conjunto foi o count.pl que já realiza a extração e a contagem de freqüência para o grau de extração especificado por parâmetro (2-gram, 3-gram,..., n- gram). e gera um arquivo com os bigrams extraídos e a freqüência de cada um, no formato observado na Figura 2. O programa em Perl foi executado diretamente do Scilab 5, por meio de uma função do sistema denominada perl, própria para chamadas de programas desenvolvidos nessa linguagem. Foi necessário que os dados produzidos pelo sistema em Java, que continha as seqüências de aminoácidos de todas as cadeias de uma determinada proteína, pudessem ser utilizados pelo sistema desenvolvido em Scilab. Para realizar o intercâmbio de dados, foi especificado um formato para arquivos texto, para que estes pudessem cumprir o papel. Na etapa 4, uma matriz contendo as freqüências de bigrams das seqüências foi criada. As freqüências foram convertidas para o intervalo Figura 2 85 total de bigrams THR<>CYS<> CYS<>PRO<> CYS<>SER<> VAL<>THR<>2 6 9 bigrams dos aminoácidos freqüência do bigram freqüência do 1º aminoácido freqüência do 2º aminoácido Formato do arquivo gerado pelo count.pl 3 Guide User Interface 4 5 Pacote de software científico para computação numérica. [0; 1], sendo que o bigram de maior freqüência recebeu o valor 1 e as demais ficaram em razão da maior. Os bigrams que não apareciam na seqüência tiveram suas freqüências atribuídas como zero. Sendo o alfabeto dos aminoácidos constituído por 20 letras, utilizando-se a codificação bigram, obtém-se 400 substrings. De forma genérica o total de padrões é dado por m n, onde m é o número de letras diferentes do alfabeto e n é o grau de extração escolhido (2-gram, 3-gram,..., n-gram) [8]. O diagrama mostrado na Figura 3 apresenta sinteticamente as etapas 2, 3 e 4 que foram aplicadas neste método. O segundo método é a codificação utilizando a escala de hidrofobicidade elaborada por Kyte e Doolittle (1982), também denominada escala KD, que foi utilizada em Weinert e Lopes (2003) para codificar os 20 aminoácidos em uma representação numérica, conforme a Tabela 1. Arquivo FASTA Montagem Matriz Leitura e concatenação Contagem Freqüência Figura 3 - Diagrama das etapas de codificação usando n-gram Tabela 1 Valores reais atribuídos a cada aminoácido conforme escala de hidrofobicidade Aminoácido Escala KD Valor Real Categoria I +4,5 0,05 Hidrofóbico V +4,2 0,10 Hidrofóbico L +3,8 0,15 Hidrofóbico F +2,8 0,20 Hidrofóbico C +2,5 0,25 Hidrofóbico M +1,9 0,30 Hidrofóbico A +1,8 0,35 Hidrofóbico G -0,4 0,40 Neutro T -0,7 0,45 Neutro S -0,8 0,50 Neutro W -0,9 0,55 Neutro Y -1,3 0,60 Neutro P -1,6 0,65 Neutro H -3,2 0,70 Hidrofílico Q -3,5 0,75 Hidrofílico N -3,5 0,80 Hidrofílico E -3,5 0,85 Hidrofílico D -3,5 0,90 Hidrofílico K -3,9 0,95 Hidrofílico R -4,0 1,00 Hidrofílico

4 Como cada proteína possui um número variado de aminoácidos em sua seqüência e não foi utilizado nenhum método de contagem de freqüências, como os n-grams, fez-se necessário a divisão das seqüências de proteínas em subconjuntos. Seja k um número determinado de aminoácidos presentes em cada subconjunto, e t o número de aminoácidos que constituem a proteína, o número de subconjuntos necessários para uma proteína é dado pela equação (1). t n (1) k Assim o número máximo de subconjuntos será dado pela proteína constituída pelo maior número de aminoácidos. Se a equação (1) não resultar em um número inteiro, deve-se desprezar a parte fracionária, ignorando assim uma parte dos aminoácidos. Cada rede neural necessária para treinar esse conjunto de dados deverá ser constituída por k entradas, e o número de redes necessárias é determinado pelo maior valor de n encontrado. Em todo o processo de codificação foi utilizada apenas a linguagem Java e a classe biojava. O mesmo conjunto de proteínas e conseqüentemente os mesmos arquivos FASTA do método de codificação anterior foram utilizados. A Figura 4 mostra o diagrama das etapas de codificação para este método. Arquivo FASTA Resultados Leitura e concatenação Codificação utilizando a escala de hidrofobicidade Figura 4 - Diagrama da codificação utilizando a escala de hidrofobicidade Os métodos de codificação utilizando n-grams e a escala de hidrofobicidade dos aminoácidos foram implementados e testados com as amostras de proteínas obtidas do site PDB. Destes testes foram extraídos os tempos (em segundos) necessários para o processamento. Os resultados estão separados por classes funcionais das proteínas e podem ser observados na Tabela 2. Os dados de saída gerados pelo sistema são conjuntos de números reais que representam de forma numérica o alfabeto dos aminoácidos presentes nas proteínas. Esses dados serão utilizados como entrada para as fases de treinamento e teste das redes neurais artificiais, que realizarão a classificação de proteínas utilizando essas informações. Tabela 2 - Tempo de processamento para os diferentes métodos de codificação implementados Classe funcional n-gram Hidrofobicidade Hydrolase Lyase Oxygen-Transport Toxin Immunoglobulin Total A grande diferença de tempo entre os métodos propostos pode ser justificada principalmente pelo fato de que o método que utiliza n-grams necessita de uma etapa para montagem das matrizes de entrada. Para cada proteína é feito um produto cartesiano entre a matriz contendo as 400 combinações possíveis do alfabeto dos aminoácidos utilizando 2-gram com a quantidade de bigrams encontrados em cada proteína. Discussão e Conclusões Antes de utilizar as redes neurais como forma de solução é necessário realizar uma abstração do problema em questão. Para a utilização no processo de classificação de proteínas há diversas formas de realizar a interpretação das proteínas para que dados em formato apropriado possam ser passados como entrada para a rede. Esses dados podem ser a seqüência linear de aminoácidos, uma determinada interpretação biológica ou por meio de um esquema de codificação híbrido como, por exemplo, utilizando os motivos das proteínas juntamente com sua seqüência linear em n-grams. Para se obter uma boa taxa de exatidão na classificação de proteínas é necessário conseguir extrair características que contenham informações importantes para o processamento da rede, de forma que esta consiga aprender a realizar o mapeamento entre os dados de entrada e saída. Como dito anteriormente a fase de codificação constitui uma das principais etapas para alcançar sucesso na aprendizagem da rede neural. 1. Artigos em Revistas e Anais e Capítulos de Livros Wu, C.H., Ermongkonchai, A., Chang, T.C. (1991), Protein classification using a neural network database system, In: ANNA 91: Proceedings of the conference on Analysis of neural network applications, New York: ACM Press, p Weinert, W. R., Lopes, H. S. (2003). Aplicação de um sistema neural ao problema de

5 classificação de proteínas, In: Anais do VI Congresso Brasileiro de Redes Neurais, São Paulo. v. 1, p Cohen, J. (2004), Bioinformatics-An introduction for computer scientists, ACM Comput. Surv., New York: ACM Press, v. 36, n. 2, p Nelson, D.L., Cox, M.M. (2002), Aminoácidos, Peptídeos e Proteínas, In: Lehninger Princípios de Bioquímica. 3a. ed. São Paulo: Sarvier, p Altschul, S.F., Gish, W., Miller, W., Myers, E.W. & Lipman, D.J. (1990) Basic local alignment search tool. J. Mol. Biol., v. 215 p.: Eddy, S.R. (1998) Profile hidden Markov models. Bioinformatics, v. 14, no.9, p Wu, C. H., Zhap, S., Chen, H. L., Lo, C. J., and McLarty, J. (1996). Motif identification neural design for rapid and sensitive protein family search. CABIOS, v. 12, p Wu, C., Whitson, G., Mclarty, J., Ermongkonchai, A., Chang, T. C. (1992), Protein classification artificial neural system. Protein Science, v. I, p Mahleko, B., Wombacher, A., Fankhauser, P. (2005), Process-annotated Service Discovery facilitated by an n-gram based index, In: IEEE Intl. Confernce on e-technology, e-commerce and e-service, Washington: IEEE Computer Society, p Kyte, J., Doolittle, R. (1982), A simple method for displaying the hydropathic character of proteins, Journal of Molecular Biology, 157, p Contatos Professora Dra. Maria Angélica de Oliveira Camargo Brunetto é professora do curso de Ciência da Computação da Universidade Estadual de Londrina e coordenadora do laboratório PROTEM. para contato: Telefone de contato: (43) André Luis Debiaso Rossi é graduando do quarto ano de Ciência da Computação da Universidade Estadual de Londrina. para contato: Telefone de contato: (43)

TÉCNICAS DE COMPUTAÇÃO PARALELA PARA MELHORAR O TEMPO DA MINERAÇÃO DE DADOS: Uma análise de Tipos de Coberturas Florestais

TÉCNICAS DE COMPUTAÇÃO PARALELA PARA MELHORAR O TEMPO DA MINERAÇÃO DE DADOS: Uma análise de Tipos de Coberturas Florestais UNIVERSIDADE ESTADUAL DE PONTA GROSSA PRÓ-REITORIA DE PESQUISA E PÓS-GRADUAÇÃO PROGRAMA DE PÓS-GRADUAÇÃO EM COMPUTAÇÃO APLICADA CRISTIAN COSMOSKI RANGEL DE ABREU TÉCNICAS DE COMPUTAÇÃO PARALELA PARA MELHORAR

Leia mais

Nathalie Portugal Vargas

Nathalie Portugal Vargas Nathalie Portugal Vargas 1 Introdução Trabalhos Relacionados Recuperação da Informação com redes ART1 Mineração de Dados com Redes SOM RNA na extração da Informação Filtragem de Informação com Redes Hopfield

Leia mais

Automatização do processo de determinação do número de ciclos de treinamento de uma Rede Neural Artificial

Automatização do processo de determinação do número de ciclos de treinamento de uma Rede Neural Artificial Automatização do processo de determinação do número de ciclos de treinamento de uma Rede Neural Artificial André Ricardo Gonçalves 1, Maria Angélica de Oliveira Camargo Brunetto 2 1,2 Laboratório de Pesquisa

Leia mais

Desenvolvimento de uma Ferramenta. Cromatogramas

Desenvolvimento de uma Ferramenta. Cromatogramas Desenvolvimento de uma Ferramenta Web para análise automática tica de Cromatogramas Faculdade de Filosofia Ciências e Letras de Ribeirão Preto - USP Faculdade de Medicina de Ribeirão Preto USP Lariza Laura

Leia mais

Automatização do processo de determinação do número de ciclos de treinamento de uma Rede Neural Artificial

Automatização do processo de determinação do número de ciclos de treinamento de uma Rede Neural Artificial Automatização do processo de determinação do número de ciclos de treinamento de uma Rede Neural Artificial André Ricardo Gonçalves; Maria Angélica de Oliveira Camargo Brunetto Laboratório Protem Departamento

Leia mais

Palavras-chave: Sistema neuro-fuzzy, Sistemas de avaliação, Sistemas Adaptativos.

Palavras-chave: Sistema neuro-fuzzy, Sistemas de avaliação, Sistemas Adaptativos. ANÁLISE DO CURSO DE ENGENHARIA ELÉTRICA NA UERJ A PARTIR DE INDICADORES CONSTRUÍDOS BASEADOS NO EXAME NACIONAL DE CURSOS: UM SISTEMA NEBULOSO DE AVALIAÇÃO Maria Luiza F. Velloso mlfv@centroin.com.br Universidade

Leia mais

Comunicado Técnico ISSN 1677-8464

Comunicado Técnico ISSN 1677-8464 Ministério da Agricultura, Pecuária e Abastecimento Comunicado Técnico Dezembro, 37 2002 Campinas, SP ISSN 1677-8464 Análise do Grau de Conservação de Resíduos em Proteínas com Estrutura 3D Resolvida Utilizando

Leia mais

METODOLOGIAS ESTATÍSTICAS APLICADAS A DADOS DE ANÁLISES QUÍMICAS DA ÁGUA PRODUZIDA EM UM CAMPO MADURO DE PETRÓLEO

METODOLOGIAS ESTATÍSTICAS APLICADAS A DADOS DE ANÁLISES QUÍMICAS DA ÁGUA PRODUZIDA EM UM CAMPO MADURO DE PETRÓLEO UNIVERSIDADE FEDERAL DO RIO GRANDE DO NORTE CENTRO DE TECNOLOGIA CT CENTRO DE CIÊNCIAS EXATAS E DA TERRA CCET PROGRAMA DE PÓS-GRADUAÇÃO EM CIÊNCIA E ENGENHARIA DE PETRÓLEO - PPGCEP DISSERTAÇÃO DE MESTRADO

Leia mais

FILTRAGEM DE INFORMAÇÃO NA WEB USANDO REDE NEURAL DE HOPFIELD E ONTOLOGIA

FILTRAGEM DE INFORMAÇÃO NA WEB USANDO REDE NEURAL DE HOPFIELD E ONTOLOGIA FILTRAGEM DE INFORMAÇÃO NA WEB USANDO REDE NEURAL DE HOPFIELD E ONTOLOGIA Daniel Mandelli Martins Faculdade de Engenharia de Computação CEATEC danielmartins@puc-campinas.edu.br Juan Manuel Adán Coello

Leia mais

Explorando bancos de dados genômicos e introdução à bioinformática. Guilherme Targino Valente Marcos Tadeu Geraldo. Bioinformática

Explorando bancos de dados genômicos e introdução à bioinformática. Guilherme Targino Valente Marcos Tadeu Geraldo. Bioinformática Explorando bancos de dados genômicos e introdução à bioinformática Guilherme Targino Valente Marcos Tadeu Geraldo 22/07/2011 Bioinformática É a aplicação de estatística e ciência da computação no campo

Leia mais

UNIVERSIDADE FEDERAL DE VIÇOSA BIOINFORMÁTICA ESTRUTURAL: PREDIÇÃO DE ESTRUTURA 3D DE PROTEÍNAS

UNIVERSIDADE FEDERAL DE VIÇOSA BIOINFORMÁTICA ESTRUTURAL: PREDIÇÃO DE ESTRUTURA 3D DE PROTEÍNAS UNIVERSIDADE FEDERAL DE VIÇOSA BIOINFORMÁTICA ESTRUTURAL: PREDIÇÃO DE ESTRUTURA 3D DE PROTEÍNAS 2 BIOINFORMÁTICA ESTRUTURAL Área da bioinformática que se aplica ao estudo da estrutura das moléculas Desafio

Leia mais

COMPARAÇÃO DE SEQÜÊNCIAS DE DNA

COMPARAÇÃO DE SEQÜÊNCIAS DE DNA 144 COMPARAÇÃO DE SEQÜÊNCIAS DE DNA PUCCI NETO, João 1 Resumo: A comparação de seqüências é uma operação básica muito importante na área de biologia computacional. Neste trabalho, é implementado um algoritmo

Leia mais

PROTÓTIPO DE SOFTWARE PARA APRENDIZAGEM DE REDES NEURAIS ARTIFICIAIS

PROTÓTIPO DE SOFTWARE PARA APRENDIZAGEM DE REDES NEURAIS ARTIFICIAIS Anais do XXXIV COBENGE. Passo Fundo: Ed. Universidade de Passo Fundo, Setembro de 2006. ISBN 85-7515-371-4 PROTÓTIPO DE SOFTWARE PARA APRENDIZAGEM DE REDES NEURAIS ARTIFICIAIS Rejane de Barros Araújo rdebarros_2000@yahoo.com.br

Leia mais

Análise e visualização de dados utilizando redes neurais artificiais auto-organizáveis

Análise e visualização de dados utilizando redes neurais artificiais auto-organizáveis Análise e visualização de dados utilizando redes neurais artificiais auto-organizáveis Adriano Lima de Sá Faculdade de Computação Universidade Federal de Uberlândia 20 de junho de 2014 Adriano L. Sá (UFU)

Leia mais

Miguel Rocha Dep. Informática - Universidade do Minho. BIOINFORMÁTICA: passado, presente e futuro!!

Miguel Rocha Dep. Informática - Universidade do Minho. BIOINFORMÁTICA: passado, presente e futuro!! Miguel Rocha Dep. Informática - Universidade do Minho BIOINFORMÁTICA: passado, presente e futuro!! Bragança, 11 de Maio de 2006 Porquê a Bioinformática?! Novas tecnologias experimentais da Biologia Molecular

Leia mais

SISTEMAS DE APRENDIZADO PARA A IDENTIFICAÇÃO DO NÚMERO DE CAROÇOS DO FRUTO PEQUI LEARNING SYSTEMS FOR IDENTIFICATION OF PEQUI FRUIT SEEDS NUMBER

SISTEMAS DE APRENDIZADO PARA A IDENTIFICAÇÃO DO NÚMERO DE CAROÇOS DO FRUTO PEQUI LEARNING SYSTEMS FOR IDENTIFICATION OF PEQUI FRUIT SEEDS NUMBER SISTEMAS DE APRENDIZADO PARA A IDENTIFICAÇÃO DO NÚMERO DE CAROÇOS DO FRUTO PEQUI Fernando Luiz de Oliveira 1 Thereza Patrícia. P. Padilha 1 Conceição A. Previero 2 Leandro Maciel Almeida 1 RESUMO O processo

Leia mais

PALAVRAS-CHAVE: Massas Nodulares, Classificação de Padrões, Redes Multi- Layer Perceptron.

PALAVRAS-CHAVE: Massas Nodulares, Classificação de Padrões, Redes Multi- Layer Perceptron. 1024 UMA ABORDAGEM BASEADA EM REDES PERCEPTRON MULTICAMADAS PARA A CLASSIFICAÇÃO DE MASSAS NODULARES EM IMAGENS MAMOGRÁFICAS Luan de Oliveira Moreira¹; Matheus Giovanni Pires² 1. Bolsista PROBIC, Graduando

Leia mais

Descoberta de Domínio Conceitual de Páginas Web

Descoberta de Domínio Conceitual de Páginas Web paper:25 Descoberta de Domínio Conceitual de Páginas Web Aluno: Gleidson Antônio Cardoso da Silva gleidson.silva@posgrad.ufsc.br Orientadora: Carina Friedrich Dorneles dorneles@inf.ufsc.br Nível: Mestrado

Leia mais

Previsão do Índice da Bolsa de Valores do Estado de São Paulo utilizandoredes Neurais Artificiais

Previsão do Índice da Bolsa de Valores do Estado de São Paulo utilizandoredes Neurais Artificiais Previsão do Índice da Bolsa de Valores do Estado de São Paulo utilizandoredes Neurais Artificiais Redes Neurais Artificiais Prof. Wilian Soares João Vitor Squillace Teixeira Ciência da Computação Universidade

Leia mais

Bioinformática Aula 01

Bioinformática Aula 01 Bioinformática Aula 01 Prof. Ricardo Martins Ramos * * Doutorando em Genética e Toxicologia Aplicada CEFET-PI/ULBRA-RS Linha de Pesquisa Bioinformática Estrutural E-mail: ricardo@cefetpi.br Visão Holística

Leia mais

Extensão do WEKA para Métodos de Agrupamento com Restrição de Contigüidade

Extensão do WEKA para Métodos de Agrupamento com Restrição de Contigüidade Extensão do WEKA para Métodos de Agrupamento com Restrição de Contigüidade Carlos Eduardo R. de Mello, Geraldo Zimbrão da Silva, Jano M. de Souza Programa de Engenharia de Sistemas e Computação Universidade

Leia mais

Introdução ao SRS Sequence Retrieval System. Marcelo Falsarella Carazzolle

Introdução ao SRS Sequence Retrieval System. Marcelo Falsarella Carazzolle Introdução ao SRS Sequence Retrieval System Marcelo Falsarella Carazzolle Resumo Motivação Introdução Bancos de Dados Ferramentas de bioinformática SRS Exemplos Motivação Existem muitos bancos de dados

Leia mais

Pesquisador em Saúde Pública Prova Discursiva INSTRUÇÕES

Pesquisador em Saúde Pública Prova Discursiva INSTRUÇÕES Biologia computacional Pesquisador em Saúde Pública Prova Discursiva 1. Você recebeu do fiscal o seguinte material: INSTRUÇÕES a) Este Caderno de Questões contendo o enunciado das 2 (duas) questões da

Leia mais

Bioinformática. Licenciaturas em Biologia, Bioquímica, Biotecnologia, Ciências Biomédicas, Engenharia Biológica. João Varela jvarela@ualg.

Bioinformática. Licenciaturas em Biologia, Bioquímica, Biotecnologia, Ciências Biomédicas, Engenharia Biológica. João Varela jvarela@ualg. Bioinformática Licenciaturas em Biologia, Bioquímica, Biotecnologia, Ciências Biomédicas, Engenharia Biológica João Varela jvarela@ualg.pt Docentes Paulo Martel (alinhamentos, pesquisas de sequências em

Leia mais

Sistema Web para Projeto de PCR

Sistema Web para Projeto de PCR Sistema Web para Projeto de PCR Abstract. This paper describes a web system that help the work of molecular biologists, automatizating the steps necessary for preparing a PCR experiment. This system will

Leia mais

CLASSIFICAÇÃO DE PROTEÍNAS COM REDES NEURAIS ARTIFICIAIS PROTEIN CLASSIFICATION WITH NEURAL NETWORKS

CLASSIFICAÇÃO DE PROTEÍNAS COM REDES NEURAIS ARTIFICIAIS PROTEIN CLASSIFICATION WITH NEURAL NETWORKS CLASSIFICAÇÃO DE PROTEÍNAS COM REDES NEURAIS ARTIFICIAIS Tiago Amador Coelho UFLA Universidade Federal de Lavras Cx Postal 3037 CEP 37200-000 Lavras (MG) tcoelho@comp.ufla.br Resumo: Pelo fato de ainda

Leia mais

Anais do XV ENCITA 2009, ITA, Outubro, 19-22, 2009,

Anais do XV ENCITA 2009, ITA, Outubro, 19-22, 2009, Anais do 5 O Encontro de Iniciação Científica e Pós-Graduação do ITA XV ENCITA / 009 Instituto Tecnológico de Aeronáutica São José dos Campos SP Brasil Outubro 9 a 009. INTERPOLAÇÃO PARABÓLICA EM INTEGRADOR

Leia mais

Revista Hispeci & Lema On Line ano III n.3 nov. 2012 ISSN 1980-2536 unifafibe.com.br/hispecielemaonline Centro Universitário UNIFAFIBE Bebedouro-SP

Revista Hispeci & Lema On Line ano III n.3 nov. 2012 ISSN 1980-2536 unifafibe.com.br/hispecielemaonline Centro Universitário UNIFAFIBE Bebedouro-SP Reconhecimento de face utilizando banco de imagens monocromáticas e coloridas através dos métodos da análise do componente principal (PCA) e da Rede Neural Artificial (RNA) [Recognition to face using the

Leia mais

Software para detecção de repetições encadeadas (SSR) em sequências de DNA

Software para detecção de repetições encadeadas (SSR) em sequências de DNA Software para detecção de repetições encadeadas (SSR) em sequências de DNA Daniel Xavier de Sousa 1, Wellington Santos Martins 1, and David Bertioli 2 1 Universidade Católica de Goiás, Goiânia, Brasil,

Leia mais

SISTEMAS COM AMORTECIMENTO NÃO-PROPORCIONAL NO DOMÍNIO DA FREQÜÊNCIA

SISTEMAS COM AMORTECIMENTO NÃO-PROPORCIONAL NO DOMÍNIO DA FREQÜÊNCIA SISTEMAS COM AMORTECIMENTO NÃO-PROPORCIONAL NO DOMÍNIO DA FREQÜÊNCIA Zacarias Martin Chamberlain Pravia Professor - Faculdade de Engenharia e Arquitetura - Universidade de Passo Fundo/UFP zacarias@upf.br

Leia mais

Programa Interunidades de Pós-Graduação em Bioinformática - Universidade de São Paulo

Programa Interunidades de Pós-Graduação em Bioinformática - Universidade de São Paulo *Tópicos e Bibliografia da Prova de Seleção em Bioinformática Área: Biológicas 1 Estrutura e Função de ácidos nucleicos 1.1 Fluxo da Informação genética 1.2 Blocos estruturais do DNA e RNA 1.3 Níveis de

Leia mais

Anotação de Genomas. Fabiana G. S. Pinto

Anotação de Genomas. Fabiana G. S. Pinto Anotação de Genomas Fabiana G. S. Pinto Obtenção de Seqüências geradas pelo MegaBace 1000 Dados brutos (medidas analógicas) de saída do seqüênciamento Base calling BIOINFORMÁTICA * PHRED: - Transforma

Leia mais

MINERAÇÃO DE DADOS PARA DETECÇÃO DE SPAMs EM REDES DE COMPUTADORES

MINERAÇÃO DE DADOS PARA DETECÇÃO DE SPAMs EM REDES DE COMPUTADORES MINERAÇÃO DE DADOS PARA DETECÇÃO DE SPAMs EM REDES DE COMPUTADORES Kelton Costa; Patricia Ribeiro; Atair Camargo; Victor Rossi; Henrique Martins; Miguel Neves; Ricardo Fontes. kelton.costa@gmail.com; patriciabellin@yahoo.com.br;

Leia mais

Bioinformática. Alinhamento de Sequências. Prof. Msc. Rommel Ramos

Bioinformática. Alinhamento de Sequências. Prof. Msc. Rommel Ramos Bioinformática Alinhamento de Sequências Prof. Msc. Rommel Ramos 2013 Sumário 1. Comparação de Sequências 2. O que é alinhamento? 3. Tipos de Alinhamento 4. Algoritmos 5. Métodos de Alinhamento Comparação

Leia mais

Identificação de Caracteres com Rede Neuronal Artificial com Interface Gráfica

Identificação de Caracteres com Rede Neuronal Artificial com Interface Gráfica Identificação de Caracteres com Rede Neuronal Artificial com Interface Gráfica João Paulo Teixeira*, José Batista*, Anildio Toca**, João Gonçalves**, e Filipe Pereira** * Departamento de Electrotecnia

Leia mais

Hipóteses Estatísticas Testadas por Diversos Softwares em Modelos com Dois Fatores Cruzados e Dados Desbalanceados

Hipóteses Estatísticas Testadas por Diversos Softwares em Modelos com Dois Fatores Cruzados e Dados Desbalanceados TEMA Tend. Mat. Apl. Comput., 5, No. 1 (24), 117-124. c Uma Publicação da Sociedade Brasileira de Matemática Aplicada e Computacional. Hipóteses Estatísticas Testadas por Diversos Softwares em Modelos

Leia mais

Gerenciamento de Workflows Científicos em Bioinformática

Gerenciamento de Workflows Científicos em Bioinformática Gerenciamento de Workflows Científicos em Bioinformática Agosto de 2007 Estudante: Orientador: Co-orientadora: Luciano Antonio Digiampietri João Carlos Setubal Claudia Bauzer Medeiros Roteiro Introdução

Leia mais

Relatório Iniciação Científica

Relatório Iniciação Científica Relatório Iniciação Científica Ambientes Para Ensaios Computacionais no Ensino de Neurocomputação e Reconhecimento de Padrões Bolsa: Programa Ensinar com Pesquisa-Pró-Reitoria de Graduação Departamento:

Leia mais

O processo da Expressão Gênica

O processo da Expressão Gênica Coordenadoria de Educação e Difusão de Ciências Rua 9 de Julho, 1205 - São Carlos - São Paulo e-mail: cbme@if.sc.usp.br- Telefone: (16) 3373-9159 http://cbme.ifsc.usp.br http://cbme.usp.br O processo da

Leia mais

Desenvolvimento de uma Ferramenta Web para análise automática de Cromatogramas

Desenvolvimento de uma Ferramenta Web para análise automática de Cromatogramas Desenvolvimento de uma Ferramenta Web para análise automática de Cromatogramas Lariza Laura de Oliveira, Gisele Helena Barboni Miranda, Kelly Christiane Ynoue, Vitor Soares Pereira, Fernando Sequeira Sousa,

Leia mais

Estudos Iniciais do Sistema didático para análise de sinais no domínio da frequência DSA-PC: tipos de janelas temporais.

Estudos Iniciais do Sistema didático para análise de sinais no domínio da frequência DSA-PC: tipos de janelas temporais. Estudos Iniciais do Sistema didático para análise de sinais no domínio da frequência DSA-PC: tipos de janelas temporais. Patricia Alves Machado Telecomunicações, Instituto Federal de Santa Catarina machadopatriciaa@gmail.com

Leia mais

ANÁLISE DE PRÉ-PROCESSAMENTO NO DESEMPENHO DE PREVISÃO DE SÉRIES TEMPORAIS FINANCEIRAS

ANÁLISE DE PRÉ-PROCESSAMENTO NO DESEMPENHO DE PREVISÃO DE SÉRIES TEMPORAIS FINANCEIRAS Universidade Federal de Pernambuco Centro de Informática Graduação em Ciência da Computação ANÁLISE DE PRÉ-PROCESSAMENTO NO DESEMPENHO DE PREVISÃO DE SÉRIES TEMPORAIS FINANCEIRAS PROPOSTA DE TRABALHO DE

Leia mais

AVALIAÇÃO DO CMSEARCH DO PACOTE INFERNAL E PLANEJAMENTO DE MÉTODOS PARA O CÁLCULO DA ESTRUTURA SECUNDÁRIA EM COMPUTAÇÃO DE ALTO DESEMPENHO

AVALIAÇÃO DO CMSEARCH DO PACOTE INFERNAL E PLANEJAMENTO DE MÉTODOS PARA O CÁLCULO DA ESTRUTURA SECUNDÁRIA EM COMPUTAÇÃO DE ALTO DESEMPENHO AVALIAÇÃO DO CMSEARCH DO PACOTE INFERNAL E PLANEJAMENTO DE MÉTODOS PARA O CÁLCULO DA ESTRUTURA SECUNDÁRIA EM COMPUTAÇÃO DE ALTO DESEMPENHO Nunes RM*, Kashiwabara AY*[Co-orientador], Shishido HY*[Co-orientador],

Leia mais

Verificação de Impressões Digitais usando Algoritmos Genéticos

Verificação de Impressões Digitais usando Algoritmos Genéticos 1. Introdução Verificação de Impressões Digitais usando Algoritmos Genéticos Matheus Giovanni Pires, Fernando Vieira Duarte, Adilson Gonzaga Escola de Engenharia de São Carlos Universidade de São Paulo

Leia mais

Aplicação de um Metamodelo de Contexto a uma Tarefa de Investigação Policial

Aplicação de um Metamodelo de Contexto a uma Tarefa de Investigação Policial Aplicação de um Metamodelo de Contexto a uma Tarefa de Investigação Policial Lucas A. de Oliveira, Rui A. R. B. Figueira, Expedito C. Lopes Mestrado em Sistemas e Computação Universidade de Salvador (UNIFACS)

Leia mais

Análise de técnicas de selecção de atributos em Bioinformática

Análise de técnicas de selecção de atributos em Bioinformática Análise de técnicas de selecção de atributos em Bioinformática Rui Mendes 100378011 Bioinformática 10/11 DCC Artigo Base Yvan Saeys, Inaki Inza and Pedro Larranaga. A review of feature selection techniques

Leia mais

Renato Maia Silva. Redes Neurais Artificiais aplicadas à Detecção de Intrusão em Redes TCP/IP. Dissertação de Mestrado

Renato Maia Silva. Redes Neurais Artificiais aplicadas à Detecção de Intrusão em Redes TCP/IP. Dissertação de Mestrado Renato Maia Silva Redes Neurais Artificiais aplicadas à Detecção de Intrusão em Redes TCP/IP Dissertação de Mestrado Dissertação apresentada como requisito parcial para obtenção do grau de Mestre pelo

Leia mais

5º CONGRESSO BRASILEIRO DE PESQUISA E DESENVOLVIMENTO EM PETRÓLEO E GÁS

5º CONGRESSO BRASILEIRO DE PESQUISA E DESENVOLVIMENTO EM PETRÓLEO E GÁS 5º CONGRESSO BRASILEIRO DE PESQUISA E DESENVOLVIMENTO EM PETRÓLEO E GÁS TÍTULO DO TRABALHO: REDES NEURAIS APLICADAS EM INDÚSTRIAS PETROQUÍMICAS DE FABRICAÇÃO DE FIBRAS DE POLIÉSTER. AUTORES: Lívia Maciel

Leia mais

Engenharia Reversa para Recuperação de Modelos de Sistemas Desenvolvidos em PL/SQL

Engenharia Reversa para Recuperação de Modelos de Sistemas Desenvolvidos em PL/SQL Engenharia Reversa para Recuperação de Modelos de Sistemas Desenvolvidos em PL/SQL Rodnei Couto 1, Luana Lachtermacher 1, Soeli Fiorini 1, Akeo Tanabe 1, Gustavo Carvalho 1, Arndt von Staa 1, Ricardo Choren

Leia mais

Table 1. Dados do trabalho

Table 1. Dados do trabalho Título: Desenvolvimento de geradores de aplicação configuráveis por linguagens de padrões Aluno: Edison Kicho Shimabukuro Junior Orientador: Prof. Dr. Paulo Cesar Masiero Co-Orientadora: Prof a. Dr. Rosana

Leia mais

6º Congresso Interinstitucional de Iniciação Científica - CIIC 2012 13 a 15 de agosto de 2012 Jaguariúna, SP

6º Congresso Interinstitucional de Iniciação Científica - CIIC 2012 13 a 15 de agosto de 2012 Jaguariúna, SP DESENVOLVIMENTO DO WEBSERVICE EGENT ESTUDO GRÁFICO DA EVOLUÇÃO DOS N-GRAMS NO TEMPO GABRIEL L. A. LIMA 1 ; LEANDRO H. M. de OLIVEIRA 2 12616 RESUMO Este trabalho apresenta um conjunto de ferramentas computacionais

Leia mais

Bioinformática Histórico e conceitos básicos

Bioinformática Histórico e conceitos básicos Bioinformática Histórico e conceitos básicos Raimundo Lima da S. Júnior M.Sc. Departamento de Biologia Núcleo de Pesquisas Replicon PUC-GO Silva Jr., RL Casamento entre a ciência da computação e a biologia

Leia mais

3 Metodologia de Previsão de Padrões de Falha

3 Metodologia de Previsão de Padrões de Falha 3 Metodologia de Previsão de Padrões de Falha Antes da ocorrência de uma falha em um equipamento, ele entra em um regime de operação diferente do regime nominal, como descrito em [8-11]. Para detectar

Leia mais

Classificação Rápida de Faltas em Sistemas Elétricos Utilizando Redes Neurais Artificiais

Classificação Rápida de Faltas em Sistemas Elétricos Utilizando Redes Neurais Artificiais Proceedings of the IV Brazilian Conference on Neural Networks - IV Congresso Brasileiro de Redes Neurais pp. 281-286, July 2-22, 1999 - ITA, São José dos Campos - SP - Brazil Classificação Rápida de Faltas

Leia mais

MLP (Multi Layer Perceptron)

MLP (Multi Layer Perceptron) MLP (Multi Layer Perceptron) André Tavares da Silva andre.silva@udesc.br Roteiro Rede neural com mais de uma camada Codificação de entradas e saídas Decorar x generalizar Perceptron Multi-Camada (MLP -

Leia mais

Relatório de uma Aplicação de Redes Neurais

Relatório de uma Aplicação de Redes Neurais UNIVERSIDADE ESTADUAL DE MONTES CLAROS CENTRO DE CIÊNCIAS EXATAS E TECNOLÓGICAS DEPARTAMENTO DE CIÊNCIAS DA COMPUTACAÇÃO ESPECIALIZAÇÃO EM ENGENHARIA DE SISTEMAS DISCIPLINA: REDES NEURAIS PROFESSOR: MARCOS

Leia mais

Conteúdo. 1 Introdução. MINUTA Histograma do 1o Sorteio da NF Salvador xxx/2014. 1º Sorteio Eletrônico da Nota Fiscal Salvador

Conteúdo. 1 Introdução. MINUTA Histograma do 1o Sorteio da NF Salvador xxx/2014. 1º Sorteio Eletrônico da Nota Fiscal Salvador 1º Sorteio Eletrônico da Nota Fiscal Salvador Relatório parcial contendo resultados 1 da análise estatística dos bilhetes premiados Conteúdo 1 Introdução O software de Sorteio Eletrônico da Nota Fiscal

Leia mais

Uma Arquitetura de Linha de Produto Baseada em Componentes para Sistemas de Gerenciamento de Workflow

Uma Arquitetura de Linha de Produto Baseada em Componentes para Sistemas de Gerenciamento de Workflow Uma Arquitetura de Linha de Produto Baseada em Componentes para Sistemas de Gerenciamento de Workflow Itana M. S. Gimenes 1 itana@din.uem.br Fabrício R. Lazilha 2 fabricio@cesumar.br Edson A. O. Junior

Leia mais

Extração de Regras de Redes Neurais via Algoritmos Genéticos

Extração de Regras de Redes Neurais via Algoritmos Genéticos Proceedings of the IV Brazilian Conference on Neural Networks - IV Congresso Brasileiro de Redes Neurais pp. 158-163, July 20-22, 1999 - ITA, São José dos Campos - SP - Brazil Extração de Regras de Redes

Leia mais

Padronização de Processos: BI e KDD

Padronização de Processos: BI e KDD 47 Padronização de Processos: BI e KDD Nara Martini Bigolin Departamento da Tecnologia da Informação -Universidade Federal de Santa Maria 98400-000 Frederico Westphalen RS Brazil nara.bigolin@ufsm.br Abstract:

Leia mais

Utilização da programação de computadores em Estatística

Utilização da programação de computadores em Estatística Universidade Federal de Minas Gerais Luana Sílvia dos Santos Utilização da programação de computadores em Estatística Belo Horizonte Dezembro, 2012 O computador tem desempenhado um papel muito importante

Leia mais

Aula 2 RNA Arquiteturas e Treinamento

Aula 2 RNA Arquiteturas e Treinamento 2COP229 Aula 2 RNA Arquiteturas e Treinamento 2COP229 Sumário 1- Arquiteturas de Redes Neurais Artificiais; 2- Processos de Treinamento; 2COP229 1- Arquiteturas de Redes Neurais Artificiais -Arquitetura:

Leia mais

Análise e Modelagem de Perda de Pacotes em Redes 802.11 em Ambientes Indoor

Análise e Modelagem de Perda de Pacotes em Redes 802.11 em Ambientes Indoor SBRC 2007 - Sessão de Artigos Curtos II 1117 Análise e Modelagem de Perda de Pacotes em Redes 802.11 em Ambientes Indoor Kleber V. Cardoso 1,José F. de Rezende 1 1 GTA - PEE - COPPE Universidade Federal

Leia mais

Mineração de Dados Meteorológicos pela Teoria dos Conjuntos Aproximativos para Aplicação na Previsão de Precipitação Sazonal

Mineração de Dados Meteorológicos pela Teoria dos Conjuntos Aproximativos para Aplicação na Previsão de Precipitação Sazonal Anais do CNMAC v.2 ISSN 1984-820X Mineração de Dados Meteorológicos pela Teoria dos Conjuntos Aproximativos para Aplicação na Previsão de Precipitação Sazonal Juliana Aparecida Anochi Instituto Nacional

Leia mais

Desenvolvimento de um Sistema Híbrido para Rastreamento

Desenvolvimento de um Sistema Híbrido para Rastreamento Desenvolvimento de um Sistema Híbrido para Rastreamento de Objetos aplicado ao Futebol de Robôs Eduardo W. Basso 1, Diego M. Pereira 2, Paulo Schreiner 2 1 Laboratório de Robótica Inteligente Instituto

Leia mais

Uma aplicação de Inteligência Computacional e Estatística Clássica na Previsão do Mercado de Seguros de Automóveis Brasileiro

Uma aplicação de Inteligência Computacional e Estatística Clássica na Previsão do Mercado de Seguros de Automóveis Brasileiro Uma aplicação de Inteligência Computacional e Estatística Clássica na Previsão do Mercado de Seguros de Automóveis Brasileiro Tiago Mendes Dantas t.mendesdantas@gmail.com Departamento de Engenharia Elétrica,

Leia mais

UM PROTÓTIPO DO SISTEMA PARA CONTROLE DE BIBLIOTECAS POR MEIO DE PÁGINAS WEB DINÂMICAS 1

UM PROTÓTIPO DO SISTEMA PARA CONTROLE DE BIBLIOTECAS POR MEIO DE PÁGINAS WEB DINÂMICAS 1 UM PROTÓTIPO DO SISTEMA PARA CONTROLE DE BIBLIOTECAS POR MEIO DE PÁGINAS WEB DINÂMICAS 1 Daniel de Faveri HONORATO 2, Renato Bobsin MACHADO 3, Huei Diana LEE 4, Feng Chung WU 5 Escrito para apresentação

Leia mais

UNIVERSIDADE ESTADUAL DE CAMPINAS. Instituto de Matemática, Estatística e Computação Científica

UNIVERSIDADE ESTADUAL DE CAMPINAS. Instituto de Matemática, Estatística e Computação Científica UNIVERSIDADE ESTADUAL DE CAMPINAS Instituto de Matemática, Estatística e Computação Científica Relatório Final - MS777 Modelagem matemático/probabilística dos módulos acústicos e de linguagem de sistemas

Leia mais

Redes neurais aplicadas na identificação de variedades de soja

Redes neurais aplicadas na identificação de variedades de soja Redes neurais aplicadas na identificação de variedades de soja Fábio R. R. Padilha Universidade Regional do Noroeste do Estado do Rio Grande do Sul - UNIJUÍ Rua São Francisco, 5 - Sede Acadêmica, 987-,

Leia mais

RELATÓRIOS TÉCNICOS DO ICMC

RELATÓRIOS TÉCNICOS DO ICMC Instituto de Ciências Matemáticas e de Computação ISSN - 0103-2569 Descrição do ambiente computacional TP-DISCOVER para mapear informações não estruturadas em uma tabela atributo-valor Daniel de Faveri

Leia mais

BACO BAse de Co-Ocorrências

BACO BAse de Co-Ocorrências BACO? BACO BAse de Co-Ocorrências Luís Sarmento O BACO é uma base de dados que guarda informação gerada a partir um processamento efectuado a um ou vários corpora. O objectivo: Permitir pesquisar rapidamente

Leia mais

Modelagem por Homologia passo-a-passo. Prof. Rommel Ramos

Modelagem por Homologia passo-a-passo. Prof. Rommel Ramos Modelagem por Homologia passo-a-passo Prof. Rommel Ramos 1 Busca de um candidato a template Para identificar os melhores candidatos a template é necessário fazer o download do banco de dados de estruturas

Leia mais

Palavras chave: defeitos de solda, pulso eco, redes neurais artificiais, transformada de wavelet

Palavras chave: defeitos de solda, pulso eco, redes neurais artificiais, transformada de wavelet DETECÇÃO DE DEFEITOS EM JUNTAS SOLDADAS UTILIZANDO UM CLASSIFICADOR NEURAL ALIMENTADO POR SINAIS ULTRASSÔNICOS PRÉ- PROCESSADOS PELA TRANSFORMADA DE WAVELET Francisco G. de Paula¹, Maria Cléa S. de Albuquerque

Leia mais

XIII Encontro de Iniciação Científica IX Mostra de Pós-graduação 06 a 11 de outubro de 2008 BIODIVERSIDADE TECNOLOGIA DESENVOLVIMENTO

XIII Encontro de Iniciação Científica IX Mostra de Pós-graduação 06 a 11 de outubro de 2008 BIODIVERSIDADE TECNOLOGIA DESENVOLVIMENTO XIII Encontro de Iniciação Científica IX Mostra de Pós-graduação 06 a 11 de outubro de 2008 BIODIVERSIDADE TECNOLOGIA DESENVOLVIMENTO EPE0147 UTILIZAÇÃO DA MINERAÇÃO DE DADOS EM UMA AVALIAÇÃO INSTITUCIONAL

Leia mais

Classificação de Imagens Tomográficas de Ciência dos Solos Utilizando Redes Neurais e Combinação de Classificadores

Classificação de Imagens Tomográficas de Ciência dos Solos Utilizando Redes Neurais e Combinação de Classificadores Classificação de Imagens Tomográficas de Ciência dos Solos Utilizando Redes Neurais e Combinação de Classificadores Fabricio Aparecido Breve Prof. Dr. Nelson Delfino d Ávila Mascarenhas Apresentação Objetivos

Leia mais

Banco de Dados aplicado a Sistemas Biológicos

Banco de Dados aplicado a Sistemas Biológicos Dados Biológicos Banco de Dados aplicado a Sistemas Biológicos A internet mudou a maneira como os cientistas compartilham os dados e possibilitou que um depósito central de informações atendesse totalmente

Leia mais

Reconhecimento de ações humanas utilizando histogramas de gradiente e vetores de tensores localmente agregados

Reconhecimento de ações humanas utilizando histogramas de gradiente e vetores de tensores localmente agregados Reconhecimento de ações humanas utilizando histogramas de gradiente e vetores de tensores localmente agregados Luiz Maurílio da Silva Maciel 1, Marcelo Bernardes Vieira 1 1 Departamento de Ciência da Computação

Leia mais

Complemento II Noções Introdutória em Redes Neurais

Complemento II Noções Introdutória em Redes Neurais Complemento II Noções Introdutória em Redes Neurais Esse documento é parte integrante do material fornecido pela WEB para a 2ª edição do livro Data Mining: Conceitos, técnicas, algoritmos, orientações

Leia mais

Aprendizagem de Máquina

Aprendizagem de Máquina Aprendizagem de Máquina Alessandro L. Koerich Programa de Pós-Graduação em Informática Pontifícia Universidade Católica do Paraná (PUCPR) Horários Aulas Sala [quinta-feira, 7:30 12:00] Atendimento Segunda

Leia mais

ANÁLISE DO PROCESSO DE MISTURA DE ÁGUA E CAL UTILIZANDO O SCILAB

ANÁLISE DO PROCESSO DE MISTURA DE ÁGUA E CAL UTILIZANDO O SCILAB ANÁLISE DO PROCESSO DE MISTURA DE ÁGUA E CAL UTILIZANDO O SCILAB Brunela Bonatto Milli 1, Danielly Cristina Gripa 2, George Simonelli 3, Victor Matheus Alves 4 1. Graduada em Engenharia Química pela Faculdade

Leia mais

RECONHECIMENTO DE OBJETOS CONTIDOS EM IMAGENS ATRAVÉS DE REDES NEURAIS

RECONHECIMENTO DE OBJETOS CONTIDOS EM IMAGENS ATRAVÉS DE REDES NEURAIS RECONHECIMENTO DE OBJETOS CONTIDOS EM IMAGENS ATRAVÉS DE REDES NEURAIS LUIZ EDUARDO NICOLINI DO PATROCÍNIO NUNES Departamento de Engenharia Mecânica Universidade de Taubaté PEDRO PAULO LEITE DO PRADO Departamento

Leia mais

EQUAÇÃO DE CHUVAS INTENSAS PARA O MUNICÍPIO DE JOAÇABA/SC

EQUAÇÃO DE CHUVAS INTENSAS PARA O MUNICÍPIO DE JOAÇABA/SC EQUAÇÃO DE CHUVAS INTENSAS PARA O MUNICÍPIO DE JOAÇABA/SC Daiani Rosa 1 ; Elfride Anrain Lindner 2 ; Angelo Mendes Massignam 3 RESUMO As relações entre a intensidade, duração e freqüência de chuvas podem

Leia mais

Bioinformática. João Varela jvarela@ualg.pt. Aula T4 CURSOS EM BIOLOGIA, BIOQUÍMICA, BIOTECNOLOGIA, CIÊNCIAS BIOMÉDICAS E ENGENHARIA BIOLÓGICA

Bioinformática. João Varela jvarela@ualg.pt. Aula T4 CURSOS EM BIOLOGIA, BIOQUÍMICA, BIOTECNOLOGIA, CIÊNCIAS BIOMÉDICAS E ENGENHARIA BIOLÓGICA Bioinformática CURSOS EM BIOLOGIA, BIOQUÍMICA, BIOTECNOLOGIA, CIÊNCIAS BIOMÉDICAS E ENGENHARIA BIOLÓGICA João Varela jvarela@ualg.pt Aula T4 Esquema de anotação Annothaton 1. Determinar a localização das

Leia mais

AMBIENTE GRÁFICO PARA VISUALIZAÇÃO DE FLUXOS E PERDAS EM REDES ELÉTRICAS

AMBIENTE GRÁFICO PARA VISUALIZAÇÃO DE FLUXOS E PERDAS EM REDES ELÉTRICAS AMBIENTE GRÁFICO PARA VISUALIZAÇÃO DE FLUXOS E PERDAS EM REDES ELÉTRICAS Delberis A. Lima delberis@aluno.feis.unesp.br Eduardo S. Hoji shigueo@aluno.feis.unesp.br Antônio M. Cossi cossi@aluno.feis.unesp.br

Leia mais

O que são domínios protéicos

O que são domínios protéicos Domínios protéicos O que são domínios protéicos Domínios protéicos é uma parte da cadeia polipeptídica que pode de enovelar independentemente para formar uma estrutura compacta e estável A existência de

Leia mais

Extração de Conhecimento a partir dos Sistemas de Informação

Extração de Conhecimento a partir dos Sistemas de Informação Extração de Conhecimento a partir dos Sistemas de Informação Gisele Faffe Pellegrini & Katia Collazos Grupo de Pesquisa em Eng. Biomédica Universidade Federal de Santa Catarina Jorge Muniz Barreto Prof.

Leia mais

Classificação de QoS em Conteúdo Multimídia para Rede VPN utilizando Rede Neural Multilayer Perceptron

Classificação de QoS em Conteúdo Multimídia para Rede VPN utilizando Rede Neural Multilayer Perceptron Classificação de QoS em Conteúdo Multimídia para Rede VPN utilizando Rede Neural Multilayer Perceptron Paula Letícia S. Lima 1, Helvio Seabra V. Filho 1, Rian Sérgio A. Lima 1, Ananias Pereira Neto 1 1

Leia mais

UMA IMPLEMENTAÇÃO EM LINGUAGEM JAVA DE ALGORITMO DE CLASSIFICAÇÃO BASEADO NO MÉTODO DA INSERÇÃO DIRETA

UMA IMPLEMENTAÇÃO EM LINGUAGEM JAVA DE ALGORITMO DE CLASSIFICAÇÃO BASEADO NO MÉTODO DA INSERÇÃO DIRETA UMA IMPLEMENTAÇÃO EM LINGUAGEM JAVA DE ALGORITMO DE CLASSIFICAÇÃO BASEADO NO MÉTODO DA INSERÇÃO DIRETA 1 BIM,Pedro Henrique Marana; 1 RABALDELLI, Diego José Caíres; 1 SOARES, Luis Antonio; 2 TAMAE, Rodrigo

Leia mais

Alinhamento Múltiplo de Seqüências Protéicas Utilizando Algoritmos Genéticos, Programação Dinâmica e Processamento Distribuído

Alinhamento Múltiplo de Seqüências Protéicas Utilizando Algoritmos Genéticos, Programação Dinâmica e Processamento Distribuído linhamento Múltiplo de Seqüências Protéicas Utilizando lgoritmos Genéticos, Programação Dinâmica e Processamento Distribuído Deisner Castravechi, ilton. Shinoda, Maria ngélica O. C Brunetto, Robinson Hoto

Leia mais

Prof. Msc. Paulo Muniz de Ávila

Prof. Msc. Paulo Muniz de Ávila Prof. Msc. Paulo Muniz de Ávila O que é Data Mining? Mineração de dados (descoberta de conhecimento em bases de dados): Extração de informação interessante (não-trivial, implícita, previamente desconhecida

Leia mais

Mineração de Dados: Introdução e Aplicações

Mineração de Dados: Introdução e Aplicações Mineração de Dados: Introdução e Aplicações Luiz Henrique de Campos Merschmann Departamento de Computação Universidade Federal de Ouro Preto luizhenrique@iceb.ufop.br Apresentação Luiz Merschmann Engenheiro

Leia mais

Desenvolvimento de uma Rede de Distribuição de Arquivos. Development of a File Distribution Network

Desenvolvimento de uma Rede de Distribuição de Arquivos. Development of a File Distribution Network Desenvolvimento de uma Rede de Distribuição de Arquivos Development of a File Distribution Network Desenvolvimento de uma Rede de Distribuição de Arquivos Development of a File Distribution Network Talles

Leia mais

Cadeias de Markov. Geovany A. Borges gaborges@ene.unb.br

Cadeias de Markov. Geovany A. Borges gaborges@ene.unb.br 36341 - Introdução aos Processos Estocásticos Curso de Pós-Graduação em Engenharia Elétrica Departamento de Engenharia Elétrica Universidade de Brasília Cadeias de Markov Geovany A. Borges gaborges@ene.unb.br

Leia mais

O processo da Expressão Gênica

O processo da Expressão Gênica INBEQMeDI Instituto Nacional de Biotecnologia Estrutural e Química Medicinal em Doenças Infecciosas Coordenadoria de Educação e Difusão de Ciências Telefone: (16) 3373-9159 Rua 9 de julho, 1205 - Centro

Leia mais

TÍTULO: SIMULAÇÃO DE METODOLOGIA BASEADA EM REDES DE KOHONEN PARA IDENTIFICAÇÃO DE CORRENTES DE INRUSH NA PROTEÇÃO DE TRANSFORMADORES DE POTÊNCIA

TÍTULO: SIMULAÇÃO DE METODOLOGIA BASEADA EM REDES DE KOHONEN PARA IDENTIFICAÇÃO DE CORRENTES DE INRUSH NA PROTEÇÃO DE TRANSFORMADORES DE POTÊNCIA TÍTULO: SIMULAÇÃO DE METODOLOGIA BASEADA EM REDES DE KOHONEN PARA IDENTIFICAÇÃO DE CORRENTES DE INRUSH NA PROTEÇÃO DE TRANSFORMADORES DE POTÊNCIA CATEGORIA: CONCLUÍDO ÁREA: ENGENHARIAS E ARQUITETURA SUBÁREA:

Leia mais

Segurança de Informações e Comunicação: Uma visão acadêmica

Segurança de Informações e Comunicação: Uma visão acadêmica Segurança de Informações e Comunicação: Uma visão acadêmica Instituto Tecnológico de Aeronáutica Laboratório de Segurança Inteligente de Informações (LABIN) Paulo André L. Castro Prof. Dr. pauloac@ita.br

Leia mais

enbsp - NBioBSP NITGEN Biometric Service Provider SDK Manual do Desenvolvedor SDK version 4.xx

enbsp - NBioBSP NITGEN Biometric Service Provider SDK Manual do Desenvolvedor SDK version 4.xx Índice: CAPÍTULO 1. INTRODUÇÃO... 3 Módulo NBioBSP COM... 3 Módulo NBioBSP Class Library... 3 Módulo Data Conversion... 3 Módulo Image Conversion... 3 1.1 CARACTERÍSTICAS... 4 Interface Gráfica para o

Leia mais

Análise e Desenvolvimento de Sistema de Estimação de Modelos da Classe STAR-TREE

Análise e Desenvolvimento de Sistema de Estimação de Modelos da Classe STAR-TREE Bernardo da Rocha Spindel Análise e Desenvolvimento de Sistema de Estimação de Modelos da Classe STAR-TREE Dissertação de Mestrado Dissertação apresentada como requisito parcial para obtenção do grau de

Leia mais

CONSIDERAÇÕES SOBRE MÉTODOS DE DECISÃO MULTICRITÉRIO. Roterdan Moura da Silva, Mischel Carmen Neyra Belderrain, IC

CONSIDERAÇÕES SOBRE MÉTODOS DE DECISÃO MULTICRITÉRIO. Roterdan Moura da Silva, Mischel Carmen Neyra Belderrain, IC CONSIDERAÇÕES SOBRE MÉTODOS DE DECISÃO MULTICRITÉRIO Roterdan Moura da Silva, Mischel Carmen Neyra Belderrain, IC Instituto Tecnológico de Aeronáutica / Divisão de Engenharia Mecânica-Aeronáutica, roterdan05@hotmail.com;

Leia mais