Métodos de Codificação de Proteínas para Uso com Redes Neurais Artificiais

Tamanho: px
Começar a partir da página:

Download "Métodos de Codificação de Proteínas para Uso com Redes Neurais Artificiais"

Transcrição

1 Métodos de Codificação de Proteínas para Uso com Redes Neurais Artificiais André Luis Debiaso Rossi 1, Maria Angélica de Oliveira Camargo Brunetto 2 1,2 Departamento de Computação, Universidade Estadual de Londrina (UEL), Brasil Resumo - A classificação de proteínas é uma tarefa que requer alto custo computacional. Diferentes métodos são utilizados para esta classificação, sendo um deles as Redes Neurais Artificiais. Para uso desta abordagem é necessário a codificação do alfabeto representando os aminoácidos em valores numéricos. Nesse contexto, esse trabalho tem como objetivo analisar dois diferentes métodos de codificação: usando uma função hashing denominada n-gram e outro usando uma escala de hidrofobicidade dos aminoácidos. Os métodos foram implementados e testados para várias proteínas do banco de dados PDB e pode-se observar que o método usando n-gram tem maior custo computacional, porém é o método que obteve melhores resultados na literatura e pode ser adaptado para diferentes valores de n a serem testados na tarefa de classificação. Palavras-chave: codificação, classificação de proteínas, n-gram, hidrofobicidade. Abstract - Protein classification is a task that requires high computational cost. Among the different ways to perform such classification, there are those based on Artificial Neural Networks. Using this approach requires codifying the alphabet that represents the amino acids in numerical values. In this context, this work aims to analyze two different codification methods: using a hashing function named n-gram and other using an amino acids hydrofobicity scale. The methods have been implemented and tested for several proteins from the PDB database and it was observed that the method using n-gram presents a higher computational cost, however it's the method which obtained better results in literature and can be adapted for different values of n to be tested on the classification task. Key-words: codification, protein classification, n-gram, hydrofobicity. Introdução Os esforços despendidos no seqüenciamento de diversos organismos proporcionaram o surgimento, em ritmo acelerado, de enormes bancos de dados biológicos, principalmente de DNA, RNA e proteínas. Um fator importante no projeto genômico é a mineração desses dados para a obtenção de maiores informações sobre esses organismos. A bioinformática se tornou essencial no objetivo de manipular esses dados a fim de extrair conhecimento, tornando possível a criação de novos medicamentos e tratamentos de doenças genéticas [1], [2] e [3]. Em se tratando de proteínas, há nos bancos de dados públicos um enorme número de seqüências. Cada proteína é formada por seqüências de aminoácidos, sendo estes representados por um alfabeto composto de 20 letras [4]. Diversos modos de classificação estão sendo realizados para facilitar o entendimento e a análise destas proteínas, sendo as redes neurais artificiais uma abordagem utilizada para esse propósito. Dentre outras abordagens conhecidas podemos citar as ferramentas de alinhamento, como a BLAST (Basic Local Align Search Tool) [5], as cadeias ocultas de Markov (Hidden Markov Models - HMM) [6] e os algoritmos genéticos. Alguns estudos realizados por Wu et al (1996) com redes neurais e programas clássicos utilizados em bioinformática, como é o caso do BLAST, obtiveram taxas de exatidão muito próximas, porém o desempenho das redes neurais é muito superior, devido ao fato do tempo de processamento não estar confinado ao tamanho das seqüências. Para utilizar as redes neurais como abordagem de classificação de proteínas, é necessário realizar a codificação do alfabeto que representa os aminoácidos em valores numéricos, pelo fato das redes aceitarem apenas variáveis numéricas como dados de entrada. Métodos de Codificação O método de codificação constitui uma das

2 principais fases para que se obtenha alta taxa de exatidão e um melhor desempenho da rede neural durante o processo de classificação [8]. É possível observar através da literatura avanços na taxa de exatidão devido a diferenças no esquema de codificação utilizado. As seqüências de aminoácidos podem ser interpretadas de diferentes formas, de acordo com um sentido biológico ou pela sua própria seqüência linear, e a partir dessa interpretação os dados são codificados. Nos trabalhos apresentados em [1] e [8], é utilizado um tipo de função hashing denominada n-gram nas seguintes interpretações das seqüências: a) grupo de troca; b) grupo estrutural; c) grupo de hidrofobicidade; além da seqüência linear de aminoácidos. Em Wu et al. (1996) também é utilizado n-grams em motifs ( motivos ) de proteínas [7]. Os motivos ou simplesmente dobras, são arranjos particularmente estáveis de diversos elementos de estrutura secundária e das conexões entre eles [4]. O grupo de troca refere-se a aminoácidos que podem ser substituídos por outros aminoácidos sem alterar a estrutura protéica. O grupo estrutural refere-se a grupos de proteínas que mantém as mesmas similaridades estruturais e o grupo de hidrofobicidade indica as proteínas que mantém um grau de repulsão à água semelhantes. Os n-grams possuem a vantagem de permitir que o tamanho da seqüência apresentada à rede não varie e torna possível a classificação baseada na localização de regiões de similaridade das proteínas [8]. Os n-grams de uma forma simples é uma maneira de representar uma cadeia longa de string em muitas substrings de tamanho n. Os n-grams, segundo Mahleko, Wombacher e Fankhauser (2005), são utilizados com os seguintes objetivos gerais: a) minimizar o tempo de processamento; b) garantir a não ocorrência dos falsos negativos; c) minimizar o número de falsos positivos. Essa função tem sido utilizada na indexação de textos, em particular para substring matching [9]. Utilizando-se, por exemplo, bigram (2-gram) para extração da string ABCDEFGHIJ, teríamos como resultado as seguintes substrings: AB, BC, CD, DE, EF, FG, GH, HI, IJ. Um projeto para classificação de proteínas utilizando redes neurais está sendo desenvolvido no laboratório de pesquisa PROTEM do Departamento de Computação da Universidade Estadual de Londrina, que mantém grupos de pesquisa em informática na saúde. Esse projeto pode ser dividido de forma genérica em três etapas: a) préprocessamento dos dados de entrada; b) implementação, treinamento e teste da rede; c) pósprocessamento dos resultados obtidos. Este artigo descreve a primeira etapa, ou seja, o préprocessamento dos dados de entrada. Metodologia Inicialmente realizou-se um estudo da literatura de diversos métodos de codificação utilizados no processo de classificação de proteínas usando redes neurais. Serviram como base para a codificação das seqüências de aminoácidos os trabalhos de [1], [2] e [8], que utilizaram o método de extração n-gram ([1] e [8]) e a escala de hidrofobicidade ([1], [2] e [8]) para as seqüências de aminoácidos. A implementação do processo de codificação utilizando n-grams pode ser dividido nas seguintes etapas: 1) Obtenção das seqüências de aminoácidos no formato FASTA (FAST-All); 2) Leitura dos arquivos FASTA e união das cadeias das seqüências; 3) Extração da seqüência e contagem de freqüência dos aminoácidos; 4) Montagem da matriz de entrada da rede, contendo todos os possíveis n-grams (para o n escolhido). A etapa 1 consistiu em obter as seqüências de resíduos de aminoácidos por meio do repositório de proteínas do site PDB 1 (Protein Data Bank). Foram obtidas amostras de cinco diferentes grupos funcionais (hydrolase(o.g.), immunoglobulin, lyase, oxygen transport e toxin) e 100 proteínas de cada grupo funcional, perfazendo um total de 500 proteínas. Cada grupo constituiu um arquivo no formato FASTA. Um exemplo deste formato é mostrado na Figura 1. >1ABT:A PDBID CHAIN SEQUENCE IVCHTTATSPISAVTCPPGENLCYRKMWCDAFCS SRGKVVELGCAATCPSKKPYEEVTCCSTDKCNPH PKQRPG >1ABT:B PDBID CHAIN SEQUENCE KHWVYYTCCPDT Figura 1 Arquivo FASTA da proteína de identificação 1ABT, extraída do banco de dados PDB Essa seqüência refere-se à proteína de identificação 1ABT no site PDB que é formada por duas cadeias, A e B, sendo a cadeia A formada por 74 aminoácidos e a cadeia B por 12 aminoácidos. Para a realização da etapa 2 foi utilizada a linguagem de programação Java e a classe biojava

3 para auxiliar no processo de leitura do arquivo FASTA. Esta classe provê um framework para processamento de dados biológicos para a linguagem Java, incluindo objetos para manipulação de seqüências biológicas, ferramentas para fazer GUIs 3 para análise de seqüências, além de rotinas estatísticas e outras. As proteínas estavam separadas em cadeias de seqüência, como visto no exemplo de um trecho do arquivo FASTA mostrado anteriormente, que foram concatenadas formando apenas uma seqüência e posteriormente gravada em um novo arquivo com os resíduos de aminoácidos na forma abreviada, utilizando três letras para cada aminoácido. A extração e contagem da freqüência usando 2-gram foi realizada por meio de um conjunto de programas em Perl denominado NSP 4 (Ngram Statistics Package), que permite identificar n-grams em textos. O único programa utilizado desse conjunto foi o count.pl que já realiza a extração e a contagem de freqüência para o grau de extração especificado por parâmetro (2-gram, 3-gram,..., n- gram). e gera um arquivo com os bigrams extraídos e a freqüência de cada um, no formato observado na Figura 2. O programa em Perl foi executado diretamente do Scilab 5, por meio de uma função do sistema denominada perl, própria para chamadas de programas desenvolvidos nessa linguagem. Foi necessário que os dados produzidos pelo sistema em Java, que continha as seqüências de aminoácidos de todas as cadeias de uma determinada proteína, pudessem ser utilizados pelo sistema desenvolvido em Scilab. Para realizar o intercâmbio de dados, foi especificado um formato para arquivos texto, para que estes pudessem cumprir o papel. Na etapa 4, uma matriz contendo as freqüências de bigrams das seqüências foi criada. As freqüências foram convertidas para o intervalo Figura 2 85 total de bigrams THR<>CYS<> CYS<>PRO<> CYS<>SER<> VAL<>THR<>2 6 9 bigrams dos aminoácidos freqüência do bigram freqüência do 1º aminoácido freqüência do 2º aminoácido Formato do arquivo gerado pelo count.pl 3 Guide User Interface 4 5 Pacote de software científico para computação numérica. [0; 1], sendo que o bigram de maior freqüência recebeu o valor 1 e as demais ficaram em razão da maior. Os bigrams que não apareciam na seqüência tiveram suas freqüências atribuídas como zero. Sendo o alfabeto dos aminoácidos constituído por 20 letras, utilizando-se a codificação bigram, obtém-se 400 substrings. De forma genérica o total de padrões é dado por m n, onde m é o número de letras diferentes do alfabeto e n é o grau de extração escolhido (2-gram, 3-gram,..., n-gram) [8]. O diagrama mostrado na Figura 3 apresenta sinteticamente as etapas 2, 3 e 4 que foram aplicadas neste método. O segundo método é a codificação utilizando a escala de hidrofobicidade elaborada por Kyte e Doolittle (1982), também denominada escala KD, que foi utilizada em Weinert e Lopes (2003) para codificar os 20 aminoácidos em uma representação numérica, conforme a Tabela 1. Arquivo FASTA Montagem Matriz Leitura e concatenação Contagem Freqüência Figura 3 - Diagrama das etapas de codificação usando n-gram Tabela 1 Valores reais atribuídos a cada aminoácido conforme escala de hidrofobicidade Aminoácido Escala KD Valor Real Categoria I +4,5 0,05 Hidrofóbico V +4,2 0,10 Hidrofóbico L +3,8 0,15 Hidrofóbico F +2,8 0,20 Hidrofóbico C +2,5 0,25 Hidrofóbico M +1,9 0,30 Hidrofóbico A +1,8 0,35 Hidrofóbico G -0,4 0,40 Neutro T -0,7 0,45 Neutro S -0,8 0,50 Neutro W -0,9 0,55 Neutro Y -1,3 0,60 Neutro P -1,6 0,65 Neutro H -3,2 0,70 Hidrofílico Q -3,5 0,75 Hidrofílico N -3,5 0,80 Hidrofílico E -3,5 0,85 Hidrofílico D -3,5 0,90 Hidrofílico K -3,9 0,95 Hidrofílico R -4,0 1,00 Hidrofílico

4 Como cada proteína possui um número variado de aminoácidos em sua seqüência e não foi utilizado nenhum método de contagem de freqüências, como os n-grams, fez-se necessário a divisão das seqüências de proteínas em subconjuntos. Seja k um número determinado de aminoácidos presentes em cada subconjunto, e t o número de aminoácidos que constituem a proteína, o número de subconjuntos necessários para uma proteína é dado pela equação (1). t n (1) k Assim o número máximo de subconjuntos será dado pela proteína constituída pelo maior número de aminoácidos. Se a equação (1) não resultar em um número inteiro, deve-se desprezar a parte fracionária, ignorando assim uma parte dos aminoácidos. Cada rede neural necessária para treinar esse conjunto de dados deverá ser constituída por k entradas, e o número de redes necessárias é determinado pelo maior valor de n encontrado. Em todo o processo de codificação foi utilizada apenas a linguagem Java e a classe biojava. O mesmo conjunto de proteínas e conseqüentemente os mesmos arquivos FASTA do método de codificação anterior foram utilizados. A Figura 4 mostra o diagrama das etapas de codificação para este método. Arquivo FASTA Resultados Leitura e concatenação Codificação utilizando a escala de hidrofobicidade Figura 4 - Diagrama da codificação utilizando a escala de hidrofobicidade Os métodos de codificação utilizando n-grams e a escala de hidrofobicidade dos aminoácidos foram implementados e testados com as amostras de proteínas obtidas do site PDB. Destes testes foram extraídos os tempos (em segundos) necessários para o processamento. Os resultados estão separados por classes funcionais das proteínas e podem ser observados na Tabela 2. Os dados de saída gerados pelo sistema são conjuntos de números reais que representam de forma numérica o alfabeto dos aminoácidos presentes nas proteínas. Esses dados serão utilizados como entrada para as fases de treinamento e teste das redes neurais artificiais, que realizarão a classificação de proteínas utilizando essas informações. Tabela 2 - Tempo de processamento para os diferentes métodos de codificação implementados Classe funcional n-gram Hidrofobicidade Hydrolase Lyase Oxygen-Transport Toxin Immunoglobulin Total A grande diferença de tempo entre os métodos propostos pode ser justificada principalmente pelo fato de que o método que utiliza n-grams necessita de uma etapa para montagem das matrizes de entrada. Para cada proteína é feito um produto cartesiano entre a matriz contendo as 400 combinações possíveis do alfabeto dos aminoácidos utilizando 2-gram com a quantidade de bigrams encontrados em cada proteína. Discussão e Conclusões Antes de utilizar as redes neurais como forma de solução é necessário realizar uma abstração do problema em questão. Para a utilização no processo de classificação de proteínas há diversas formas de realizar a interpretação das proteínas para que dados em formato apropriado possam ser passados como entrada para a rede. Esses dados podem ser a seqüência linear de aminoácidos, uma determinada interpretação biológica ou por meio de um esquema de codificação híbrido como, por exemplo, utilizando os motivos das proteínas juntamente com sua seqüência linear em n-grams. Para se obter uma boa taxa de exatidão na classificação de proteínas é necessário conseguir extrair características que contenham informações importantes para o processamento da rede, de forma que esta consiga aprender a realizar o mapeamento entre os dados de entrada e saída. Como dito anteriormente a fase de codificação constitui uma das principais etapas para alcançar sucesso na aprendizagem da rede neural. 1. Artigos em Revistas e Anais e Capítulos de Livros Wu, C.H., Ermongkonchai, A., Chang, T.C. (1991), Protein classification using a neural network database system, In: ANNA 91: Proceedings of the conference on Analysis of neural network applications, New York: ACM Press, p Weinert, W. R., Lopes, H. S. (2003). Aplicação de um sistema neural ao problema de

5 classificação de proteínas, In: Anais do VI Congresso Brasileiro de Redes Neurais, São Paulo. v. 1, p Cohen, J. (2004), Bioinformatics-An introduction for computer scientists, ACM Comput. Surv., New York: ACM Press, v. 36, n. 2, p Nelson, D.L., Cox, M.M. (2002), Aminoácidos, Peptídeos e Proteínas, In: Lehninger Princípios de Bioquímica. 3a. ed. São Paulo: Sarvier, p Altschul, S.F., Gish, W., Miller, W., Myers, E.W. & Lipman, D.J. (1990) Basic local alignment search tool. J. Mol. Biol., v. 215 p.: Eddy, S.R. (1998) Profile hidden Markov models. Bioinformatics, v. 14, no.9, p Wu, C. H., Zhap, S., Chen, H. L., Lo, C. J., and McLarty, J. (1996). Motif identification neural design for rapid and sensitive protein family search. CABIOS, v. 12, p Wu, C., Whitson, G., Mclarty, J., Ermongkonchai, A., Chang, T. C. (1992), Protein classification artificial neural system. Protein Science, v. I, p Mahleko, B., Wombacher, A., Fankhauser, P. (2005), Process-annotated Service Discovery facilitated by an n-gram based index, In: IEEE Intl. Confernce on e-technology, e-commerce and e-service, Washington: IEEE Computer Society, p Kyte, J., Doolittle, R. (1982), A simple method for displaying the hydropathic character of proteins, Journal of Molecular Biology, 157, p Contatos Professora Dra. Maria Angélica de Oliveira Camargo Brunetto é professora do curso de Ciência da Computação da Universidade Estadual de Londrina e coordenadora do laboratório PROTEM. para contato: Telefone de contato: (43) André Luis Debiaso Rossi é graduando do quarto ano de Ciência da Computação da Universidade Estadual de Londrina. para contato: Telefone de contato: (43)

Desenvolvimento de uma Ferramenta. Cromatogramas

Desenvolvimento de uma Ferramenta. Cromatogramas Desenvolvimento de uma Ferramenta Web para análise automática tica de Cromatogramas Faculdade de Filosofia Ciências e Letras de Ribeirão Preto - USP Faculdade de Medicina de Ribeirão Preto USP Lariza Laura

Leia mais

PALAVRAS-CHAVE: Massas Nodulares, Classificação de Padrões, Redes Multi- Layer Perceptron.

PALAVRAS-CHAVE: Massas Nodulares, Classificação de Padrões, Redes Multi- Layer Perceptron. 1024 UMA ABORDAGEM BASEADA EM REDES PERCEPTRON MULTICAMADAS PARA A CLASSIFICAÇÃO DE MASSAS NODULARES EM IMAGENS MAMOGRÁFICAS Luan de Oliveira Moreira¹; Matheus Giovanni Pires² 1. Bolsista PROBIC, Graduando

Leia mais

Nathalie Portugal Vargas

Nathalie Portugal Vargas Nathalie Portugal Vargas 1 Introdução Trabalhos Relacionados Recuperação da Informação com redes ART1 Mineração de Dados com Redes SOM RNA na extração da Informação Filtragem de Informação com Redes Hopfield

Leia mais

Análise e visualização de dados utilizando redes neurais artificiais auto-organizáveis

Análise e visualização de dados utilizando redes neurais artificiais auto-organizáveis Análise e visualização de dados utilizando redes neurais artificiais auto-organizáveis Adriano Lima de Sá Faculdade de Computação Universidade Federal de Uberlândia 20 de junho de 2014 Adriano L. Sá (UFU)

Leia mais

TÉCNICAS DE COMPUTAÇÃO PARALELA PARA MELHORAR O TEMPO DA MINERAÇÃO DE DADOS: Uma análise de Tipos de Coberturas Florestais

TÉCNICAS DE COMPUTAÇÃO PARALELA PARA MELHORAR O TEMPO DA MINERAÇÃO DE DADOS: Uma análise de Tipos de Coberturas Florestais UNIVERSIDADE ESTADUAL DE PONTA GROSSA PRÓ-REITORIA DE PESQUISA E PÓS-GRADUAÇÃO PROGRAMA DE PÓS-GRADUAÇÃO EM COMPUTAÇÃO APLICADA CRISTIAN COSMOSKI RANGEL DE ABREU TÉCNICAS DE COMPUTAÇÃO PARALELA PARA MELHORAR

Leia mais

Automatização do processo de determinação do número de ciclos de treinamento de uma Rede Neural Artificial

Automatização do processo de determinação do número de ciclos de treinamento de uma Rede Neural Artificial Automatização do processo de determinação do número de ciclos de treinamento de uma Rede Neural Artificial André Ricardo Gonçalves; Maria Angélica de Oliveira Camargo Brunetto Laboratório Protem Departamento

Leia mais

Explorando bancos de dados genômicos e introdução à bioinformática. Guilherme Targino Valente Marcos Tadeu Geraldo. Bioinformática

Explorando bancos de dados genômicos e introdução à bioinformática. Guilherme Targino Valente Marcos Tadeu Geraldo. Bioinformática Explorando bancos de dados genômicos e introdução à bioinformática Guilherme Targino Valente Marcos Tadeu Geraldo 22/07/2011 Bioinformática É a aplicação de estatística e ciência da computação no campo

Leia mais

Desenvolvimento de uma Rede de Distribuição de Arquivos. Development of a File Distribution Network

Desenvolvimento de uma Rede de Distribuição de Arquivos. Development of a File Distribution Network Desenvolvimento de uma Rede de Distribuição de Arquivos Development of a File Distribution Network Desenvolvimento de uma Rede de Distribuição de Arquivos Development of a File Distribution Network Talles

Leia mais

Complemento II Noções Introdutória em Redes Neurais

Complemento II Noções Introdutória em Redes Neurais Complemento II Noções Introdutória em Redes Neurais Esse documento é parte integrante do material fornecido pela WEB para a 2ª edição do livro Data Mining: Conceitos, técnicas, algoritmos, orientações

Leia mais

Reconhecimento de ações humanas utilizando histogramas de gradiente e vetores de tensores localmente agregados

Reconhecimento de ações humanas utilizando histogramas de gradiente e vetores de tensores localmente agregados Reconhecimento de ações humanas utilizando histogramas de gradiente e vetores de tensores localmente agregados Luiz Maurílio da Silva Maciel 1, Marcelo Bernardes Vieira 1 1 Departamento de Ciência da Computação

Leia mais

Automatização do processo de determinação do número de ciclos de treinamento de uma Rede Neural Artificial

Automatização do processo de determinação do número de ciclos de treinamento de uma Rede Neural Artificial Automatização do processo de determinação do número de ciclos de treinamento de uma Rede Neural Artificial André Ricardo Gonçalves 1, Maria Angélica de Oliveira Camargo Brunetto 2 1,2 Laboratório de Pesquisa

Leia mais

XIII Encontro de Iniciação Científica IX Mostra de Pós-graduação 06 a 11 de outubro de 2008 BIODIVERSIDADE TECNOLOGIA DESENVOLVIMENTO

XIII Encontro de Iniciação Científica IX Mostra de Pós-graduação 06 a 11 de outubro de 2008 BIODIVERSIDADE TECNOLOGIA DESENVOLVIMENTO XIII Encontro de Iniciação Científica IX Mostra de Pós-graduação 06 a 11 de outubro de 2008 BIODIVERSIDADE TECNOLOGIA DESENVOLVIMENTO EPE0147 UTILIZAÇÃO DA MINERAÇÃO DE DADOS EM UMA AVALIAÇÃO INSTITUCIONAL

Leia mais

FILTRAGEM DE INFORMAÇÃO NA WEB USANDO REDE NEURAL DE HOPFIELD E ONTOLOGIA

FILTRAGEM DE INFORMAÇÃO NA WEB USANDO REDE NEURAL DE HOPFIELD E ONTOLOGIA FILTRAGEM DE INFORMAÇÃO NA WEB USANDO REDE NEURAL DE HOPFIELD E ONTOLOGIA Daniel Mandelli Martins Faculdade de Engenharia de Computação CEATEC danielmartins@puc-campinas.edu.br Juan Manuel Adán Coello

Leia mais

UNIVERSIDADE FEDERAL DE VIÇOSA BIOINFORMÁTICA ESTRUTURAL: PREDIÇÃO DE ESTRUTURA 3D DE PROTEÍNAS

UNIVERSIDADE FEDERAL DE VIÇOSA BIOINFORMÁTICA ESTRUTURAL: PREDIÇÃO DE ESTRUTURA 3D DE PROTEÍNAS UNIVERSIDADE FEDERAL DE VIÇOSA BIOINFORMÁTICA ESTRUTURAL: PREDIÇÃO DE ESTRUTURA 3D DE PROTEÍNAS 2 BIOINFORMÁTICA ESTRUTURAL Área da bioinformática que se aplica ao estudo da estrutura das moléculas Desafio

Leia mais

Bioinformática. Licenciaturas em Biologia, Bioquímica, Biotecnologia, Ciências Biomédicas, Engenharia Biológica. João Varela jvarela@ualg.

Bioinformática. Licenciaturas em Biologia, Bioquímica, Biotecnologia, Ciências Biomédicas, Engenharia Biológica. João Varela jvarela@ualg. Bioinformática Licenciaturas em Biologia, Bioquímica, Biotecnologia, Ciências Biomédicas, Engenharia Biológica João Varela jvarela@ualg.pt Docentes Paulo Martel (alinhamentos, pesquisas de sequências em

Leia mais

Introdução. Conceitos Básicos. Conceitos Básicos. Conceitos Básicos

Introdução. Conceitos Básicos. Conceitos Básicos. Conceitos Básicos Conceitos Básicos Introdução Banco de Dados I Prof. Guilherme Tavares de Assis Universidade Federal de Ouro Preto UFOP Instituto de Ciências Exatas e Biológicas ICEB Departamento de Computação DECOM Dados

Leia mais

PROTÓTIPO DE SOFTWARE PARA APRENDIZAGEM DE REDES NEURAIS ARTIFICIAIS

PROTÓTIPO DE SOFTWARE PARA APRENDIZAGEM DE REDES NEURAIS ARTIFICIAIS Anais do XXXIV COBENGE. Passo Fundo: Ed. Universidade de Passo Fundo, Setembro de 2006. ISBN 85-7515-371-4 PROTÓTIPO DE SOFTWARE PARA APRENDIZAGEM DE REDES NEURAIS ARTIFICIAIS Rejane de Barros Araújo rdebarros_2000@yahoo.com.br

Leia mais

Hipóteses Estatísticas Testadas por Diversos Softwares em Modelos com Dois Fatores Cruzados e Dados Desbalanceados

Hipóteses Estatísticas Testadas por Diversos Softwares em Modelos com Dois Fatores Cruzados e Dados Desbalanceados TEMA Tend. Mat. Apl. Comput., 5, No. 1 (24), 117-124. c Uma Publicação da Sociedade Brasileira de Matemática Aplicada e Computacional. Hipóteses Estatísticas Testadas por Diversos Softwares em Modelos

Leia mais

Desenvolvimento do Módulo de Pré-processamento e Geração de Imagens de. Imagens de Teste do Sistema DTCOURO

Desenvolvimento do Módulo de Pré-processamento e Geração de Imagens de. Imagens de Teste do Sistema DTCOURO Desenvolvimento do Módulo de Pré-processamento e Geração de Imagens de Teste do Sistema DTCOURO Willian Paraguassu Amorim 27 de julho de 2005 1 Título Desenvolvimento do Módulo de Pré-processamento e Geração

Leia mais

Introdução à Bioinformática. Prof. IVAné@

Introdução à Bioinformática. Prof. IVAné@ Introdução à Bioinformática Prof. IVAné@ Bioinformática União da ciência da computação com a biologia molecular É uma área nova Há 10 anos atrás o termo nem existia Depois da descoberta de Watson e Crick

Leia mais

Anotação de Genomas. Fabiana G. S. Pinto

Anotação de Genomas. Fabiana G. S. Pinto Anotação de Genomas Fabiana G. S. Pinto Obtenção de Seqüências geradas pelo MegaBace 1000 Dados brutos (medidas analógicas) de saída do seqüênciamento Base calling BIOINFORMÁTICA * PHRED: - Transforma

Leia mais

Do neurônio biológico ao neurônio das redes neurais artificiais

Do neurônio biológico ao neurônio das redes neurais artificiais Do neurônio biológico ao neurônio das redes neurais artificiais O objetivo desta aula é procurar justificar o modelo de neurônio usado pelas redes neurais artificiais em termos das propriedades essenciais

Leia mais

Bioinformática Aula 01

Bioinformática Aula 01 Bioinformática Aula 01 Prof. Ricardo Martins Ramos * * Doutorando em Genética e Toxicologia Aplicada CEFET-PI/ULBRA-RS Linha de Pesquisa Bioinformática Estrutural E-mail: ricardo@cefetpi.br Visão Holística

Leia mais

UMA IMPLEMENTAÇÃO EM LINGUAGEM JAVA DE ALGORITMO DE CLASSIFICAÇÃO BASEADO NO MÉTODO DA INSERÇÃO DIRETA

UMA IMPLEMENTAÇÃO EM LINGUAGEM JAVA DE ALGORITMO DE CLASSIFICAÇÃO BASEADO NO MÉTODO DA INSERÇÃO DIRETA UMA IMPLEMENTAÇÃO EM LINGUAGEM JAVA DE ALGORITMO DE CLASSIFICAÇÃO BASEADO NO MÉTODO DA INSERÇÃO DIRETA 1 BIM,Pedro Henrique Marana; 1 RABALDELLI, Diego José Caíres; 1 SOARES, Luis Antonio; 2 TAMAE, Rodrigo

Leia mais

SISTEMAS DE APRENDIZADO PARA A IDENTIFICAÇÃO DO NÚMERO DE CAROÇOS DO FRUTO PEQUI LEARNING SYSTEMS FOR IDENTIFICATION OF PEQUI FRUIT SEEDS NUMBER

SISTEMAS DE APRENDIZADO PARA A IDENTIFICAÇÃO DO NÚMERO DE CAROÇOS DO FRUTO PEQUI LEARNING SYSTEMS FOR IDENTIFICATION OF PEQUI FRUIT SEEDS NUMBER SISTEMAS DE APRENDIZADO PARA A IDENTIFICAÇÃO DO NÚMERO DE CAROÇOS DO FRUTO PEQUI Fernando Luiz de Oliveira 1 Thereza Patrícia. P. Padilha 1 Conceição A. Previero 2 Leandro Maciel Almeida 1 RESUMO O processo

Leia mais

Descoberta de Domínio Conceitual de Páginas Web

Descoberta de Domínio Conceitual de Páginas Web paper:25 Descoberta de Domínio Conceitual de Páginas Web Aluno: Gleidson Antônio Cardoso da Silva gleidson.silva@posgrad.ufsc.br Orientadora: Carina Friedrich Dorneles dorneles@inf.ufsc.br Nível: Mestrado

Leia mais

Um processo para construção de software mais transparente

Um processo para construção de software mais transparente Um processo para construção de software mais transparente Eduardo Almentero 1, and Julio Cesar Sampaio do Prado Leite 1 1 Pontifícia Universidade Católica do Rio de Janeiro, PUC - Rio, Brasil {ealmentero,

Leia mais

UNIVERSIDADE FEDERAL DE SANTA MARIA DEPARTAMENTO DE ELETRÔNICA E COMPUTAÇÃO Programa de Pós-Graduação em Informática

UNIVERSIDADE FEDERAL DE SANTA MARIA DEPARTAMENTO DE ELETRÔNICA E COMPUTAÇÃO Programa de Pós-Graduação em Informática UNIVERSIDADE FEDERAL DE SANTA MARIA DEPARTAMENTO DE ELETRÔNICA E COMPUTAÇÃO Programa de Pós-Graduação em Informática Estudo e aperfeiçoamento da técnica de steering behaviors na simulação física de fluidos

Leia mais

ADM041 / EPR806 Sistemas de Informação

ADM041 / EPR806 Sistemas de Informação ADM041 / EPR806 Sistemas de Informação UNIFEI Universidade Federal de Itajubá Prof. Dr. Alexandre Ferreira de Pinho 1 Sistemas de Apoio à Decisão (SAD) Tipos de SAD Orientados por modelos: Criação de diferentes

Leia mais

15 Computador, projeto e manufatura

15 Computador, projeto e manufatura A U A UL LA Computador, projeto e manufatura Um problema Depois de pronto o desenho de uma peça ou objeto, de que maneira ele é utilizado na fabricação? Parte da resposta está na Aula 2, que aborda as

Leia mais

Aplicação de um Metamodelo de Contexto a uma Tarefa de Investigação Policial

Aplicação de um Metamodelo de Contexto a uma Tarefa de Investigação Policial Aplicação de um Metamodelo de Contexto a uma Tarefa de Investigação Policial Lucas A. de Oliveira, Rui A. R. B. Figueira, Expedito C. Lopes Mestrado em Sistemas e Computação Universidade de Salvador (UNIFACS)

Leia mais

Universidade Federal de Goiás Escola de Engenharia Elétrica e de Computação Laboratório de Máquinas Especiais

Universidade Federal de Goiás Escola de Engenharia Elétrica e de Computação Laboratório de Máquinas Especiais Aspectos Relacionados ao Acionamento e Controle de Velocidade de um Motor Linear a Relutância Variável. MARIANO, Rodrigo Leandro; SANTOS, Euler Bueno. Universidade Federal de Goiás Escola de Engenharia

Leia mais

Estudos Iniciais do Sistema didático para análise de sinais no domínio da frequência DSA-PC: tipos de janelas temporais.

Estudos Iniciais do Sistema didático para análise de sinais no domínio da frequência DSA-PC: tipos de janelas temporais. Estudos Iniciais do Sistema didático para análise de sinais no domínio da frequência DSA-PC: tipos de janelas temporais. Patricia Alves Machado Telecomunicações, Instituto Federal de Santa Catarina machadopatriciaa@gmail.com

Leia mais

Introdução ao SRS Sequence Retrieval System. Marcelo Falsarella Carazzolle

Introdução ao SRS Sequence Retrieval System. Marcelo Falsarella Carazzolle Introdução ao SRS Sequence Retrieval System Marcelo Falsarella Carazzolle Resumo Motivação Introdução Bancos de Dados Ferramentas de bioinformática SRS Exemplos Motivação Existem muitos bancos de dados

Leia mais

O PROJETO DE PESQUISA. Prof. Angelo Augusto Frozza, M.Sc. http://about.me/tilfrozza

O PROJETO DE PESQUISA. Prof. Angelo Augusto Frozza, M.Sc. http://about.me/tilfrozza O PROJETO DE PESQUISA Prof. Angelo Augusto Frozza, M.Sc. http://about.me/tilfrozza ROTEIRO Escolher um tema de pesquisa Por onde começar? Ler para aprender Estrutura do Projeto de Pesquisa A Definição

Leia mais

ANÁLISE DA CONSERVAÇÃO PÓS-COLHEITA DA ALFACE (Lactuca Sativa, L) UTILIZANDO O SISTEMA DE APOIO À TOMADA DE DECISÃO BKD

ANÁLISE DA CONSERVAÇÃO PÓS-COLHEITA DA ALFACE (Lactuca Sativa, L) UTILIZANDO O SISTEMA DE APOIO À TOMADA DE DECISÃO BKD ANÁLISE DA CONSERVAÇÃO PÓS-COLHEITA DA ALFACE (Lactuca Sativa, L) UTILIZANDO O SISTEMA DE APOIO À TOMADA DE DECISÃO BKD RESUMO Thereza P. P. Padilha Fabiano Fagundes Conceição Previero Laboratório de Solos

Leia mais

Palavras-chave: Sistema neuro-fuzzy, Sistemas de avaliação, Sistemas Adaptativos.

Palavras-chave: Sistema neuro-fuzzy, Sistemas de avaliação, Sistemas Adaptativos. ANÁLISE DO CURSO DE ENGENHARIA ELÉTRICA NA UERJ A PARTIR DE INDICADORES CONSTRUÍDOS BASEADOS NO EXAME NACIONAL DE CURSOS: UM SISTEMA NEBULOSO DE AVALIAÇÃO Maria Luiza F. Velloso mlfv@centroin.com.br Universidade

Leia mais

MINERAÇÃO DE DADOS PARA DETECÇÃO DE SPAMs EM REDES DE COMPUTADORES

MINERAÇÃO DE DADOS PARA DETECÇÃO DE SPAMs EM REDES DE COMPUTADORES MINERAÇÃO DE DADOS PARA DETECÇÃO DE SPAMs EM REDES DE COMPUTADORES Kelton Costa; Patricia Ribeiro; Atair Camargo; Victor Rossi; Henrique Martins; Miguel Neves; Ricardo Fontes. kelton.costa@gmail.com; patriciabellin@yahoo.com.br;

Leia mais

TÓPICOS AVANÇADOS EM ENGENHARIA DE SOFTWARE

TÓPICOS AVANÇADOS EM ENGENHARIA DE SOFTWARE TÓPICOS AVANÇADOS EM ENGENHARIA DE SOFTWARE Engenharia de Computação Professor: Rosalvo Ferreira de Oliveira Neto Estudos Comparativos Recentes - Behavior Scoring Roteiro Objetivo Critérios de Avaliação

Leia mais

Conteúdo. Disciplina: INF 02810 Engenharia de Software. Monalessa Perini Barcellos. Centro Tecnológico. Universidade Federal do Espírito Santo

Conteúdo. Disciplina: INF 02810 Engenharia de Software. Monalessa Perini Barcellos. Centro Tecnológico. Universidade Federal do Espírito Santo Universidade Federal do Espírito Santo Centro Tecnológico Departamento de Informática Disciplina: INF 02810 Prof.: (monalessa@inf.ufes.br) Conteúdo 1. Introdução 2. Processo de Software 3. Gerência de

Leia mais

Software para detecção de repetições encadeadas (SSR) em sequências de DNA

Software para detecção de repetições encadeadas (SSR) em sequências de DNA Software para detecção de repetições encadeadas (SSR) em sequências de DNA Daniel Xavier de Sousa 1, Wellington Santos Martins 1, and David Bertioli 2 1 Universidade Católica de Goiás, Goiânia, Brasil,

Leia mais

3 Metodologia de Previsão de Padrões de Falha

3 Metodologia de Previsão de Padrões de Falha 3 Metodologia de Previsão de Padrões de Falha Antes da ocorrência de uma falha em um equipamento, ele entra em um regime de operação diferente do regime nominal, como descrito em [8-11]. Para detectar

Leia mais

Table 1. Dados do trabalho

Table 1. Dados do trabalho Título: Desenvolvimento de geradores de aplicação configuráveis por linguagens de padrões Aluno: Edison Kicho Shimabukuro Junior Orientador: Prof. Dr. Paulo Cesar Masiero Co-Orientadora: Prof a. Dr. Rosana

Leia mais

Referências internas são os artefatos usados para ajudar na elaboração do PT tais como:

Referências internas são os artefatos usados para ajudar na elaboração do PT tais como: Plano de Teste (resumo do documento) I Introdução Identificador do Plano de Teste Esse campo deve especificar um identificador único para reconhecimento do Plano de Teste. Pode ser inclusive um código

Leia mais

PROPOSTA DE UM MODELO DE SISTEMA HIPERMÍDIA PARA APRESENTAÇÃO DO CURSO DE CIÊNCIA DA COMPUTAÇÃO

PROPOSTA DE UM MODELO DE SISTEMA HIPERMÍDIA PARA APRESENTAÇÃO DO CURSO DE CIÊNCIA DA COMPUTAÇÃO PROPOSTA DE UM MODELO DE SISTEMA HIPERMÍDIA PARA APRESENTAÇÃO DO CURSO DE CIÊNCIA DA COMPUTAÇÃO Fabiana Pacheco Lopes 1 1 Universidade Presidente Antônio Carlos (UNIPAC) fabipl_21@yahoo.com.br Resumo.Este

Leia mais

Figura 5.1.Modelo não linear de um neurônio j da camada k+1. Fonte: HAYKIN, 2001

Figura 5.1.Modelo não linear de um neurônio j da camada k+1. Fonte: HAYKIN, 2001 47 5 Redes Neurais O trabalho em redes neurais artificiais, usualmente denominadas redes neurais ou RNA, tem sido motivado desde o começo pelo reconhecimento de que o cérebro humano processa informações

Leia mais

Simulador de Redes Neurais Multiplataforma

Simulador de Redes Neurais Multiplataforma Simulador de Redes Neurais Multiplataforma Lucas Hermann Negri 1, Claudio Cesar de Sá 2, Ademir Nied 1 1 Departamento de Engenharia Elétrica Universidade do Estado de Santa Catarina (UDESC) Joinville SC

Leia mais

Aprendizagem de Máquina

Aprendizagem de Máquina Aprendizagem de Máquina Alessandro L. Koerich Programa de Pós-Graduação em Informática Pontifícia Universidade Católica do Paraná (PUCPR) Horários Aulas Sala [quinta-feira, 7:30 12:00] Atendimento Segunda

Leia mais

Desenvolvendo uma Arquitetura de Componentes Orientada a Serviço SCA

Desenvolvendo uma Arquitetura de Componentes Orientada a Serviço SCA Desenvolvendo uma Arquitetura de Componentes Orientada a Serviço SCA RESUMO Ricardo Della Libera Marzochi A introdução ao Service Component Architecture (SCA) diz respeito ao estudo dos principais fundamentos

Leia mais

Gerenciamento de Workflows Científicos em Bioinformática

Gerenciamento de Workflows Científicos em Bioinformática Gerenciamento de Workflows Científicos em Bioinformática Agosto de 2007 Estudante: Orientador: Co-orientadora: Luciano Antonio Digiampietri João Carlos Setubal Claudia Bauzer Medeiros Roteiro Introdução

Leia mais

Relatório de uma Aplicação de Redes Neurais

Relatório de uma Aplicação de Redes Neurais UNIVERSIDADE ESTADUAL DE MONTES CLAROS CENTRO DE CIÊNCIAS EXATAS E TECNOLÓGICAS DEPARTAMENTO DE CIÊNCIAS DA COMPUTACAÇÃO ESPECIALIZAÇÃO EM ENGENHARIA DE SISTEMAS DISCIPLINA: REDES NEURAIS PROFESSOR: MARCOS

Leia mais

Capítulo 3. Avaliação de Desempenho. 3.1 Definição de Desempenho

Capítulo 3. Avaliação de Desempenho. 3.1 Definição de Desempenho 20 Capítulo 3 Avaliação de Desempenho Este capítulo aborda como medir, informar e documentar aspectos relativos ao desempenho de um computador. Além disso, descreve os principais fatores que influenciam

Leia mais

Abordagem de Processo: conceitos e diretrizes para sua implementação

Abordagem de Processo: conceitos e diretrizes para sua implementação QP Informe Reservado Nº 70 Maio/2007 Abordagem de Processo: conceitos e diretrizes para sua implementação Tradução para o português especialmente preparada para os Associados ao QP. Este guindance paper

Leia mais

2. Sistemas Multi-Agentes (Multi-Agent System - MAS)

2. Sistemas Multi-Agentes (Multi-Agent System - MAS) AORML uma linguagem para modelagem de uma aplicação Multiagentes: Uma Aplicação no Sistema Expertcop. Hebert de Aquino Nery, Daniel Gonçalves de Oliveira e Vasco Furtado. Universidade de Fortaleza UNIFOR

Leia mais

Sistema de mineração de dados para descobertas de regras e padrões em dados médicos

Sistema de mineração de dados para descobertas de regras e padrões em dados médicos Sistema de mineração de dados para descobertas de regras e padrões em dados médicos Pollyanna Carolina BARBOSA¹; Thiago MAGELA² 1Aluna do Curso Superior Tecnólogo em Análise e Desenvolvimento de Sistemas

Leia mais

EXPERIÊNCIA DE USO DE ARQUITETURA CORPORATIVA NO PROJETO DE RES

EXPERIÊNCIA DE USO DE ARQUITETURA CORPORATIVA NO PROJETO DE RES EXPERIÊNCIA DE USO DE ARQUITETURA CORPORATIVA NO PROJETO DE RES Rigoleta Dutra Mediano Dias 1, Lívia Aparecida de Oliveira Souza 2 1, 2 CASNAV, MARINHA DO BRASIL, MINISTÉRIO DA DEFESA, BRASIL Resumo: Este

Leia mais

Frameworks. Pasteur Ottoni de Miranda Junior

Frameworks. Pasteur Ottoni de Miranda Junior Frameworks Pasteur Ottoni de Miranda Junior 1-Definição Apesar do avanço das técnicas de desenvolvimento de software, a construção de software ainda é um processo extremamente complexo.a reutilização tem

Leia mais

Revista Hispeci & Lema On Line ano III n.3 nov. 2012 ISSN 1980-2536 unifafibe.com.br/hispecielemaonline Centro Universitário UNIFAFIBE Bebedouro-SP

Revista Hispeci & Lema On Line ano III n.3 nov. 2012 ISSN 1980-2536 unifafibe.com.br/hispecielemaonline Centro Universitário UNIFAFIBE Bebedouro-SP Reconhecimento de face utilizando banco de imagens monocromáticas e coloridas através dos métodos da análise do componente principal (PCA) e da Rede Neural Artificial (RNA) [Recognition to face using the

Leia mais

Infográfico da fatura de energia elétrica em prol da Eficiência Energética

Infográfico da fatura de energia elétrica em prol da Eficiência Energética Infográfico da fatura de energia elétrica em prol da Eficiência Energética André Luis Boaventura Nathália Aparecida Lopes João Ricardo Neves Ana Maria Osório Araya Resumo A motivação para essa pesquisa

Leia mais

Complemento IV Introdução aos Algoritmos Genéticos

Complemento IV Introdução aos Algoritmos Genéticos Complemento IV Introdução aos Algoritmos Genéticos Esse documento é parte integrante do material fornecido pela WEB para a 2ª edição do livro Data Mining: Conceitos, técnicas, algoritmos, orientações e

Leia mais

RECUPERAÇÃO DE DOCUMENTOS TEXTO USANDO MODELOS PROBABILISTICOS ESTENDIDOS

RECUPERAÇÃO DE DOCUMENTOS TEXTO USANDO MODELOS PROBABILISTICOS ESTENDIDOS ISBN 978-85-61091-05-7 Encontro Internacional de Produção Científica Cesumar 27 a 30 de outubro de 2009 RECUPERAÇÃO DE DOCUMENTOS TEXTO USANDO MODELOS PROBABILISTICOS ESTENDIDOS Marcello Erick Bonfim 1

Leia mais

Instituto de Computação, Universidade Federal do Amazonas (UFAM) Manaus-AM, Brasil

Instituto de Computação, Universidade Federal do Amazonas (UFAM) Manaus-AM, Brasil Elicitação de Requisitos a partir de Modelos de Processos de Negócio e Modelos Organizacionais: Uma pesquisa para definição de técnicas baseadas em heurísticas Marcos A. B. de Oliveira 1, Sérgio R. C.

Leia mais

ANÁLISE DO PROCESSO DE MISTURA DE ÁGUA E CAL UTILIZANDO O SCILAB

ANÁLISE DO PROCESSO DE MISTURA DE ÁGUA E CAL UTILIZANDO O SCILAB ANÁLISE DO PROCESSO DE MISTURA DE ÁGUA E CAL UTILIZANDO O SCILAB Brunela Bonatto Milli 1, Danielly Cristina Gripa 2, George Simonelli 3, Victor Matheus Alves 4 1. Graduada em Engenharia Química pela Faculdade

Leia mais

PROGRAMAÇÃO AVANÇADA -CONCEITOS DE ORIENTAÇÃO A OBJETOS. Prof. Angelo Augusto Frozza, M.Sc. frozza@ifc-camboriu.edu.br

PROGRAMAÇÃO AVANÇADA -CONCEITOS DE ORIENTAÇÃO A OBJETOS. Prof. Angelo Augusto Frozza, M.Sc. frozza@ifc-camboriu.edu.br PROGRAMAÇÃO AVANÇADA -CONCEITOS DE ORIENTAÇÃO A OBJETOS Prof. Angelo Augusto Frozza, M.Sc. frozza@ifc-camboriu.edu.br ROTEIRO 1. Conceitos de Orientação a Objetos Introdução O paradigma da POO Classes

Leia mais

Comunicado Técnico ISSN 1677-8464

Comunicado Técnico ISSN 1677-8464 Ministério da Agricultura, Pecuária e Abastecimento Comunicado Técnico Dezembro, 37 2002 Campinas, SP ISSN 1677-8464 Análise do Grau de Conservação de Resíduos em Proteínas com Estrutura 3D Resolvida Utilizando

Leia mais

Análise de técnicas de selecção de atributos em Bioinformática

Análise de técnicas de selecção de atributos em Bioinformática Análise de técnicas de selecção de atributos em Bioinformática Rui Mendes 100378011 Bioinformática 10/11 DCC Artigo Base Yvan Saeys, Inaki Inza and Pedro Larranaga. A review of feature selection techniques

Leia mais

AMBIENTE GRÁFICO PARA VISUALIZAÇÃO DE FLUXOS E PERDAS EM REDES ELÉTRICAS

AMBIENTE GRÁFICO PARA VISUALIZAÇÃO DE FLUXOS E PERDAS EM REDES ELÉTRICAS AMBIENTE GRÁFICO PARA VISUALIZAÇÃO DE FLUXOS E PERDAS EM REDES ELÉTRICAS Delberis A. Lima delberis@aluno.feis.unesp.br Eduardo S. Hoji shigueo@aluno.feis.unesp.br Antônio M. Cossi cossi@aluno.feis.unesp.br

Leia mais

Redes Neurais. A IA clássica segue o paradigma da computação simbólica

Redes Neurais. A IA clássica segue o paradigma da computação simbólica Abordagens não simbólicas A IA clássica segue o paradigma da computação simbólica Redes Neurais As redes neurais deram origem a chamada IA conexionista, pertencendo também a grande área da Inteligência

Leia mais

Sistema Web para Projeto de PCR

Sistema Web para Projeto de PCR Sistema Web para Projeto de PCR Abstract. This paper describes a web system that help the work of molecular biologists, automatizating the steps necessary for preparing a PCR experiment. This system will

Leia mais

Algoritmo. Prof. Anderson Almeida Ferreira. Agradeço ao prof. Guilherme Tavares de Assis por fornecer slides que fazem parte desta apresentação

Algoritmo. Prof. Anderson Almeida Ferreira. Agradeço ao prof. Guilherme Tavares de Assis por fornecer slides que fazem parte desta apresentação 1 Algoritmo Prof. Anderson Almeida Ferreira Agradeço ao prof. Guilherme Tavares de Assis por fornecer slides que fazem parte desta apresentação Desenvolvimento de programas 2 Análise do problema Desenvolvimento

Leia mais

TIPOS ABSTRATOS DE DADOS DEFINIÇÃO E EXEMPLOS. Bruno Maffeo Departamento de Informática PUC-Rio

TIPOS ABSTRATOS DE DADOS DEFINIÇÃO E EXEMPLOS. Bruno Maffeo Departamento de Informática PUC-Rio TIPOS ABSTRATOS DE DADOS DEFINIÇÃO E EXEMPLOS Bruno Maffeo Departamento de Informática PUC-Rio TERMINOLOGIA BÁSICA ALGORITMO Um algoritmo pode ser visto como uma seqüência de ações expressas em termos

Leia mais

Após essa disciplina você vai ficar convencido que a estatística tem enorme aplicação em diversas áreas.

Após essa disciplina você vai ficar convencido que a estatística tem enorme aplicação em diversas áreas. UNIVERSIDADE FEDERAL DA PARAÍBA INTRODUÇÃO Departamento de Estatística Luiz Medeiros http://www.de.ufpb.br/~luiz/ CONCEITOS FUNDAMENTAIS DE ESTATÍSTICA O que a Estatística significa para você? Pesquisas

Leia mais

SEGMENTAÇÃO DE IMAGENS EM PLACAS AUTOMOTIVAS

SEGMENTAÇÃO DE IMAGENS EM PLACAS AUTOMOTIVAS SEGMENTAÇÃO DE IMAGENS EM PLACAS AUTOMOTIVAS André Zuconelli 1 ; Manassés Ribeiro 2 1. Aluno do Curso Técnico em Informática, turma 2010, Instituto Federal Catarinense, Câmpus Videira, andre_zuconelli@hotmail.com

Leia mais

Hashing. Estruturas de Dados. Motivação

Hashing. Estruturas de Dados. Motivação Estruturas de Dados Hashing Prof. Ricardo J. G. B. Campello Parte deste material é baseado em adaptações e extensões de slides disponíveis em http://ww3.datastructures.net (Goodrich & Tamassia). Motivação

Leia mais

COMPARAÇÃO DE SEQÜÊNCIAS DE DNA

COMPARAÇÃO DE SEQÜÊNCIAS DE DNA 144 COMPARAÇÃO DE SEQÜÊNCIAS DE DNA PUCCI NETO, João 1 Resumo: A comparação de seqüências é uma operação básica muito importante na área de biologia computacional. Neste trabalho, é implementado um algoritmo

Leia mais

Pesquisador em Saúde Pública Prova Discursiva INSTRUÇÕES

Pesquisador em Saúde Pública Prova Discursiva INSTRUÇÕES Biologia computacional Pesquisador em Saúde Pública Prova Discursiva 1. Você recebeu do fiscal o seguinte material: INSTRUÇÕES a) Este Caderno de Questões contendo o enunciado das 2 (duas) questões da

Leia mais

Programa de Pós-Graduação Stricto Sensu em Biologia Computacional e Sistemas. Seleção de Mestrado 2012-B

Programa de Pós-Graduação Stricto Sensu em Biologia Computacional e Sistemas. Seleção de Mestrado 2012-B Programa de Pós-Graduação Stricto Sensu em Biologia Computacional e Sistemas Seleção de Mestrado 2012-B INSTRUÇÕES (LEIA ATENTAMENTE ANTES DE PREENCHER A PROVA): a. Identifique sua prova unicamente com

Leia mais

DESENVOLVIMENTO DO SISTEMA DE AVALIAÇÃO DE DADOS COLETADOS POR PCD S: MÓDULOS DE VENTO, TEMPERATURA E UMIDADE RELATIVA DO AR E RADIAÇÃO SOLAR

DESENVOLVIMENTO DO SISTEMA DE AVALIAÇÃO DE DADOS COLETADOS POR PCD S: MÓDULOS DE VENTO, TEMPERATURA E UMIDADE RELATIVA DO AR E RADIAÇÃO SOLAR DESENVOLVIMENTO DO SISTEMA DE AVALIAÇÃO DE DADOS COLETADOS POR PCD S: MÓDULOS DE VENTO, TEMPERATURA E UMIDADE RELATIVA DO AR E RADIAÇÃO SOLAR Mario Rodrigues Pinto de Sousa Filho FUNCEME Fortaleza mario.rodrigues@funceme.br

Leia mais

DETERMINAÇÃO DA ESTRUTURA TRIDIMENSIONAL DE PROTEÍNAS POR DIFRAÇÃO DE RAIOS-X

DETERMINAÇÃO DA ESTRUTURA TRIDIMENSIONAL DE PROTEÍNAS POR DIFRAÇÃO DE RAIOS-X DETERMINAÇÃO DA ESTRUTURA TRIDIMENSIONAL DE PROTEÍNAS POR DIFRAÇÃO DE RAIOS-X Disciplina: Engenharia de Proteínas Ma. Flávia Campos Freitas Vieira NÍVEIS ESTRUTURAIS DAS PROTEÍNAS Fonte: Lehninger, 2010.

Leia mais

Extensão do WEKA para Métodos de Agrupamento com Restrição de Contigüidade

Extensão do WEKA para Métodos de Agrupamento com Restrição de Contigüidade Extensão do WEKA para Métodos de Agrupamento com Restrição de Contigüidade Carlos Eduardo R. de Mello, Geraldo Zimbrão da Silva, Jano M. de Souza Programa de Engenharia de Sistemas e Computação Universidade

Leia mais

Programação Concorrente Processos e Threads

Programação Concorrente Processos e Threads Programação Concorrente Processos e Threads Prof. Eduardo Alchieri Processos O conceito mais central em qualquer sistema operacional é o processo Uma abstração de um programa em execução Um programa por

Leia mais

TÍTULO: PROPOSTA DE METODOLOGIA BASEADA EM REDES NEURAIS ARTIFICIAIS MLP PARA A PROTEÇÃO DIFERENCIAL DE TRANSFORMADORES DE POTÊNCIA

TÍTULO: PROPOSTA DE METODOLOGIA BASEADA EM REDES NEURAIS ARTIFICIAIS MLP PARA A PROTEÇÃO DIFERENCIAL DE TRANSFORMADORES DE POTÊNCIA TÍTULO: PROPOSTA DE METODOLOGIA BASEADA EM REDES NEURAIS ARTIFICIAIS MLP PARA A PROTEÇÃO DIFERENCIAL DE TRANSFORMADORES DE POTÊNCIA CATEGORIA: CONCLUÍDO ÁREA: ENGENHARIAS E ARQUITETURA SUBÁREA: ENGENHARIAS

Leia mais

PROJETO DE PESQUISA MODALIDADE INICIAÇÃO CIENTÍFICA (BOLSA PIC/FACIT/FAPEMIG)

PROJETO DE PESQUISA MODALIDADE INICIAÇÃO CIENTÍFICA (BOLSA PIC/FACIT/FAPEMIG) PROJETO DE PESQUISA MODALIDADE INICIAÇÃO CIENTÍFICA (BOLSA PIC/FACIT/FAPEMIG) MONTES CLAROS FEVEREIRO/2014 COORDENAÇÃO DE PESQUISA PROGRAMA DE INICIAÇÃO CIENTÍFICA DISPOSITIVOS MÓVEIS INTELIGENTES ORIENTADOR:

Leia mais

Estudo comparativo entre dois tradicionais algoritmos de roteamento: vetor distância e estado de enlace.

Estudo comparativo entre dois tradicionais algoritmos de roteamento: vetor distância e estado de enlace. Estudo comparativo entre dois tradicionais algoritmos de roteamento: vetor distância e estado de enlace. Ederson Luis Posselt 1, Geovane Griesang 1 1 Instituto de Informática Universidade de Santa Cruz

Leia mais

Módulo 4: Gerenciamento de Dados

Módulo 4: Gerenciamento de Dados Módulo 4: Gerenciamento de Dados 1 1. CONCEITOS Os dados são um recurso organizacional decisivo que precisa ser administrado como outros importantes ativos das empresas. A maioria das organizações não

Leia mais

UM ESTUDO DE CASO SOBRE A INDEXAÇÃO AUTOMÁTICA DE DOCUMENTOS OFICIAIS DA UENP BASEADO EM LAYOUTS

UM ESTUDO DE CASO SOBRE A INDEXAÇÃO AUTOMÁTICA DE DOCUMENTOS OFICIAIS DA UENP BASEADO EM LAYOUTS UM ESTUDO DE CASO SOBRE A INDEXAÇÃO AUTOMÁTICA DE DOCUMENTOS OFICIAIS DA UENP BASEADO EM LAYOUTS Alexia Guilherme Bianque (PIBIC/CNPq), Ederson Marco Sgarbi (Orientador), a.g.bianque10@gmail.com.br Universidade

Leia mais

Renato Maia Silva. Redes Neurais Artificiais aplicadas à Detecção de Intrusão em Redes TCP/IP. Dissertação de Mestrado

Renato Maia Silva. Redes Neurais Artificiais aplicadas à Detecção de Intrusão em Redes TCP/IP. Dissertação de Mestrado Renato Maia Silva Redes Neurais Artificiais aplicadas à Detecção de Intrusão em Redes TCP/IP Dissertação de Mestrado Dissertação apresentada como requisito parcial para obtenção do grau de Mestre pelo

Leia mais

Computador E/S, Memória, Barramento do sistema e CPU Onde a CPU Registradores, ULA, Interconexão interna da CPU e Unidade de controle.

Computador E/S, Memória, Barramento do sistema e CPU Onde a CPU Registradores, ULA, Interconexão interna da CPU e Unidade de controle. Introdução Os principais elementos de um sistema de computação são a unidade central de processamento (central processing unit CPU), a memória principal, o subsistema de E/S (entrada e saída) e os mecanismos

Leia mais

ESTUDO DE CASO: LeCS: Ensino a Distância

ESTUDO DE CASO: LeCS: Ensino a Distância ESTUDO DE CASO: LeCS: Ensino a Distância HERMOSILLA, Lígia Docente da Faculdade de Ciências Jurídicas e Gerenciais de Garça FAEG - Labienópolis - CEP 17400-000 Garça (SP) Brasil Telefone (14) 3407-8000

Leia mais

IN0997 - Redes Neurais

IN0997 - Redes Neurais IN0997 - Redes Neurais Aluizio Fausto Ribeiro Araújo Universidade Federal de Pernambuco Centro de Informática - CIn Departamento de Sistemas da Computação aluizioa@cin.ufpe.br Conteúdo Objetivos Ementa

Leia mais

computador-cálculo numérico perfeita. As fases na resolução de um problema real podem, de modo geral, ser colocadas na seguinte ordem:

computador-cálculo numérico perfeita. As fases na resolução de um problema real podem, de modo geral, ser colocadas na seguinte ordem: 1 UNIVERSIDADE FEDERAL DE VIÇOSA Departamento de Matemática - CCE Cálculo Numérico - MAT 271 Prof.: Valéria Mattos da Rosa As notas de aula que se seguem são uma compilação dos textos relacionados na bibliografia

Leia mais

ARQUITETURA DE UM SISTEMA SPATIO-TEXTUAL. PALAVRAS-CHAVE: banco de dados espaciais, busca spatio-textual. aplicativo.

ARQUITETURA DE UM SISTEMA SPATIO-TEXTUAL. PALAVRAS-CHAVE: banco de dados espaciais, busca spatio-textual. aplicativo. ARQUITETURA DE UM SISTEMA SPATIO-TEXTUAL Fellipe de Lima Fonseca 1 ; João Batista Rocha-Junior 2 1. Bolsista CNPq, Graduando em Engenharia de Computação, Universidade Estadual de Feira de Santana, e-mail:

Leia mais

COMO ELABORAR UM ARTIGO CIENTÍFICO RESUMO. Palavras-chave: Artigo Científico. Normalização. NBR 6022/03.

COMO ELABORAR UM ARTIGO CIENTÍFICO RESUMO. Palavras-chave: Artigo Científico. Normalização. NBR 6022/03. ARTIGO CIENTÍFICO Texto com autoria declarada que apresenta e discute ideias, métodos, técnicas, processos e resultados de diversas áreas do conhecimento (ABNT/NBR 6022:2003). 2.1.1 Modelo de artigo COMO

Leia mais

PROJETO DE REDES www.projetoderedes.com.br

PROJETO DE REDES www.projetoderedes.com.br PROJETO DE REDES www.projetoderedes.com.br Centro Universitário de Volta Redonda - UniFOA Curso Tecnológico de Redes de Computadores 5º período Disciplina: Tecnologia WEB Professor: José Maurício S. Pinheiro

Leia mais

Redes neurais aplicadas na identificação de variedades de soja

Redes neurais aplicadas na identificação de variedades de soja Redes neurais aplicadas na identificação de variedades de soja Fábio R. R. Padilha Universidade Regional do Noroeste do Estado do Rio Grande do Sul - UNIJUÍ Rua São Francisco, 5 - Sede Acadêmica, 987-,

Leia mais

ANÁLISE DE PRÉ-PROCESSAMENTO NO DESEMPENHO DE PREVISÃO DE SÉRIES TEMPORAIS FINANCEIRAS

ANÁLISE DE PRÉ-PROCESSAMENTO NO DESEMPENHO DE PREVISÃO DE SÉRIES TEMPORAIS FINANCEIRAS Universidade Federal de Pernambuco Centro de Informática Graduação em Ciência da Computação ANÁLISE DE PRÉ-PROCESSAMENTO NO DESEMPENHO DE PREVISÃO DE SÉRIES TEMPORAIS FINANCEIRAS PROPOSTA DE TRABALHO DE

Leia mais

ESTUDO DOS DADOS DA LIXIVIAÇÃO DOS MATERIAIS DE ELETRODOS DE PILHAS EM HCl POR REDE NEURAL

ESTUDO DOS DADOS DA LIXIVIAÇÃO DOS MATERIAIS DE ELETRODOS DE PILHAS EM HCl POR REDE NEURAL ESTUDO DOS DADOS DA LIXIVIAÇÃO DOS MATERIAIS DE ELETRODOS DE PILHAS EM HCl POR REDE NEURAL Macêdo, M. I. F 1, Rosa, J. L. A. 2, Gonçalves, F. 2, Boente, A. N. P. 2 1 Laboratório de Tecnologia de Materiais,

Leia mais

RELATÓRIOS TÉCNICOS DO ICMC

RELATÓRIOS TÉCNICOS DO ICMC Instituto de Ciências Matemáticas e de Computação ISSN - 0103-2569 Descrição do ambiente computacional TP-DISCOVER para mapear informações não estruturadas em uma tabela atributo-valor Daniel de Faveri

Leia mais

Projetos. Universidade Federal do Espírito Santo - UFES. Mestrado em Informática 2004/1. O Projeto. 1. Introdução. 2.

Projetos. Universidade Federal do Espírito Santo - UFES. Mestrado em Informática 2004/1. O Projeto. 1. Introdução. 2. Pg. 1 Universidade Federal do Espírito Santo - UFES Mestrado em Informática 2004/1 Projetos O Projeto O projeto tem um peso maior na sua nota final pois exigirá de você a utilização de diversas informações

Leia mais

O processo da Expressão Gênica

O processo da Expressão Gênica Coordenadoria de Educação e Difusão de Ciências Rua 9 de Julho, 1205 - São Carlos - São Paulo e-mail: cbme@if.sc.usp.br- Telefone: (16) 3373-9159 http://cbme.ifsc.usp.br http://cbme.usp.br O processo da

Leia mais